KEGG   Helicobacter pylori 35A: HMPREF4655_20134Help
Entry
HMPREF4655_20134  CDS       T01892                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00220  Arginine biosynthesis
hpo00330  Arginine and proline metabolism
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
hpo01130  Biosynthesis of antibiotics
hpo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HMPREF4655_20134 (rocF)
   00330 Arginine and proline metabolism
    HMPREF4655_20134 (rocF)
Enzymes [BR:hpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HMPREF4655_20134 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADU40302
UniProt: E6S3P1
Structure
PDB: 

Jmol
Position
complement(136584..137552)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIVQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMREVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRESMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLKSFKDRLRAVEVTEYNPTVSAKHTNEEEKQVLE
ILDLIINSCKIKDKKPSFTMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagccttaagtgcaacgcatggcgatgtgattaaaggcatgcaa
acaatcgttcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgcgagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttgggcatggtt
ttaaatcgtgtccgtagcgggttcaatcgcatgagcgagagcgaagagaaggcatggcaa
aaactctgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgagagagatgtgattaaggaattgcaaatc
cctttatttagtgtggaagcgataagagaaagcatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggatattatttaccttagcctagatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgagctaaag
caattattaggcttacttttaaaaagctttaaagacagattaagagccgttgaggtaacc
gaatacaaccccacggtgagtgcaaaacacaccaacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagataagaagccatcttttacaatg
agtcgctga

DBGET integrated database retrieval system