KEGG   Helicobacter pylori 35A: HMPREF4655_20356Help
Entry
HMPREF4655_20356  CDS       T01892                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpo  Helicobacter pylori 35A
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF4655_20356 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF4655_20356 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF4655_20356 (thrC)
Enzymes [BR:hpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF4655_20356 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350209..351669
Genome map
AA seq 486 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLQWQDCLNLSYNELVECVFERL
GLEIPKGLLASALKCYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNDALKAHQLKLSVTNSVNFGRIAFQIIYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYVLKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKTALETLKNSYNTPDSQRLDDLFEKGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacgcgttctttgaaagaaaaaaagattgattttattgaagcgata
ttaaaccccaacgccccaaaaggcgggctttacactttagagcattttgaaacattacaa
tggcaggattgtttgaatctgagctataacgagctggtagaatgtgtgtttgagcgcttg
ggtttagagattcctaagggtttattagcaagcgctttaaaatgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttgatgctcgtttccacgagcggcgat
accggccctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacgatgctttaaaagcgcaccaattaaaattaagcgtg
actaattccgtgaattttgggcgcatcgcttttcaaatcatctatcacatttggggcttt
ttagaattgtataaaaaaggcgcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacctactcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttgatctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaagttttacgtgctaaagcctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaaccatccaa
gaagtttatgcagaacaccaatacttgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaactaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccggatagccagcgccttgatgatttatttgag
aaaggaatcaagcaccaagaagttttaaaactcaatgagatcaaatcttctatccttttg
tggttagaaaacacgcattaa

DBGET integrated database retrieval system