KEGG   Helicobacter pylori 35A: HMPREF4655_20473Help
Entry
HMPREF4655_20473  CDS       T01892                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpo  Helicobacter pylori 35A
Brite
Enzymes [BR:hpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HMPREF4655_20473
Secretion system [BR:hpo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HMPREF4655_20473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462456..463253
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLIVSKDGNLVIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQN
SAKLNAIFNEIPVDYAIELPSTNAKNKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaagcctttaaaatctagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttatagtgagt
aaggatggtaatttagtcatagggcttagcaatatcttttttagcaataaaagcgatgat
gtgcaattggtcgcagaaaccaatcaaaaagtccaagcccttaacgccacccagcaaaac
agcgcgaaattgaacgctatttttaatgaaataccggttgattatgcgatagagttgccc
tctactaacgctaaaaataaggataaaatcctttatattgtttctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtggtggggtggcttggagtcaattcagctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctatccttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaagggtgtacctttctta
taccattataaggcatga

DBGET integrated database retrieval system