KEGG   Helicobacter pylori 35A: HMPREF4655_20954Help
Entry
HMPREF4655_20954  CDS       T01892                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpo  Helicobacter pylori 35A
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF4655_20954 (galU)
   00052 Galactose metabolism
    HMPREF4655_20954 (galU)
   00500 Starch and sucrose metabolism
    HMPREF4655_20954 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF4655_20954 (galU)
Enzymes [BR:hpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF4655_20954 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(929638..930459)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDYPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaagcaggctgtgaagtgatggcaattgttacaggcagaaataagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcaccaac
aaagaaaacgccctaaaaagcattcgtaacattatagagaagtgctgtttttcctatgtg
cgccaaaaacaaatgaaaggattagggcatgcgattttaaccggagaagccctcataggc
aatgaaccttttgcggtgattttagccgatgacttatgcataagccatgattatccaagc
gtgctaaagcaaatgatttcattgtatcaaaaataccaatgctccattgtagccattgaa
gaggtggcgctagaagaagtttcaaaatacggcgtgatcaggggcgaatggttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctggccgtgatagggcgctacattctaaccccggatatttttgaaattttaagcgagacg
aaaccgggcaaaaacaatgaaatccaaatcacagacgccttactcactcaagccaaaaga
aaacgaatcatcgcttaccagttcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttgtaa

DBGET integrated database retrieval system