KEGG   Helicobacter pylori 35A: HMPREF4655_21118Help
Entry
HMPREF4655_21118  CDS       T01892                                 

Gene name
ruvA
Definition
crossover junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hpo  Helicobacter pylori 35A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF4655_21118 (ruvA)
Enzymes [BR:hpo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMPREF4655_21118 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1104481..1105032)
Genome map
AA seq 183 aa AA seqDB search
MIVGLIGVVEKISALEVHIEVQGVVYGVQVSMRTSALLQAGQKARLKILQVIKEDAHLLY
GFLEESEKILFERLLKINGVGGRIALAILSSFSPNEFENIIATKEVKRLQQVPGIGKKLA
DKIMVDLIGFFIQDETGPACNEVFLALESLGFKSAEINKVLKTLKPNLSTEAAIKEALQQ
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggtttgataggggttgtggaaaaaatctctgctttagaagtgcatatagaa
gtgcaaggggttgtttatggggtgcaagtttctatgcgaacttctgctttgcttcaagcg
ggccaaaaagcgcgtttgaaaatcttacaagtgattaaagaagatgcgcatcttttatac
gggtttttagaagagagcgaaaaaatcctctttgaaaggcttttaaaaatcaatggggta
ggggggcgtatcgctttagccattctttcaagtttttcgccaaatgaatttgaaaacatt
atcgccactaaagaagtcaaaagactccagcaagtcccaggcataggcaaaaagctcgct
gataagatcatggtggatttgattggttttttcattcaagatgaaactggccctgcgtgc
aatgaagtctttttagccctagagagtttgggttttaaaagcgctgaaatcaataaagtt
ttaaaaaccctaaaacccaatctcagcaccgaagcagcgattaaagaagccttacaacaa
ctgcgctcttaa

DBGET integrated database retrieval system