KEGG   Helicobacter pylori 35A: HMPREF4655_21158Help
Entry
HMPREF4655_21158  CDS       T01892                                 

Gene name
recR
Definition
recombination protein R
Orthology
K06187  
recombination protein RecR
Organism
hpo  Helicobacter pylori 35A
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF4655_21158 (recR)
DNA repair and recombination proteins [BR:hpo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HMPREF4655_21158 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1158730..1159311
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CASCNAISESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIKENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaaatccgcttttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcactcaagatcacgcacgctttagagaacgccctagaaaatcttaaaaca
tgcgcatcttgtaacgcgatcagtgagagtgaggtttgtgagatttgctctgatgagagc
agacaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaggat
ttaaaggattttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gctctagaaaaacgcctgattaaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctttaatgctttatattgaagataaattacagcatttccacctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggatcaaagcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system