KEGG   Helicobacter pylori 35A: HMPREF4655_21161Help
Entry
HMPREF4655_21161  CDS       T01892                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00790  Folate biosynthesis
hpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF4655_21161 (folE)
Enzymes [BR:hpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     HMPREF4655_21161 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF3638
Motif
Other DBs
NCBI-ProteinID: ADU41254
UniProt: E6S2K2
Position
1161373..1161915
Genome map
AA seq 180 aa AA seqDB search
MENFFNQFFENIGEDKNREGLKETPKRVQELWKFLYKGYKEDPRVALKSAYFQGVCDEMI
VAQNIEFYSTCEHHLLPFWGNISLGYIPKEKIVGISAIAKLIEIYSRRLQIQERLTTQIA
ETFDEIIEPRGVIVVCEAKHLCMSMQGVQKQNAIIKTSVLKGLFKKDPKTRSEFIQLLKS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttttcaaccagttttttgaaaatatcggcgaagataaaaacagagaaggt
ctaaaagagacgcctaaaagggttcaagaattatggaaattcttgtataaaggctataaa
gaagatcctagagtggctttaaaaagcgcatattttcaaggcgtttgcgatgaaatgata
gtggctcaaaacattgaattttactccacttgcgaacaccacttgctccctttttggggg
aatatcagtttaggatacattcctaaagaaaagattgtaggcattagcgcgatcgctaag
ctcattgaaatttatagcagacgcttgcaaatccaagaaaggctgaccactcaaattgcc
gaaacctttgatgaaatcatagagccaagaggcgtgattgtggtttgtgaagccaagcat
ttgtgcatgagcatgcaaggggtgcaaaagcaaaatgcgatcattaaaacaagcgttcta
aaaggtctctttaaaaaagaccctaaaaccagatctgaatttatacaactcttaaaatct
tag

DBGET integrated database retrieval system