KEGG   Helicobacter pylori 35A: HMPREF4655_21281Help
Entry
HMPREF4655_21281  CDS       T01892                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hpo  Helicobacter pylori 35A
Brite
Enzymes [BR:hpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     HMPREF4655_21281 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1288303..1288932
Genome map
AA seq 209 aa AA seqDB search
MNSIKNHLMCEEINKRFNLHPKVREAMESIEREIFVPAPFKHFAYTLNALSMQAQQYISS
PLTVAKMTQYLEIDHVDSVLEIGCGSGYQAAVLSQIFRRVFSIERIESLYIEARLRLKTL
GLNNVHVKFADGNKGWEQYAPYDRILFSACAKNIPQALIDQLEEGGILVAPIQENNEQVI
KRFVKQNNALRVQKVLEKCLFVPVVDGVQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagtattaaaaaccatttgatgtgtgaagaaatcaataagcgtttcaatttgcac
cccaaagtgagagaggctatggagagcattgaaagggaaatctttgtgccagcccctttt
aaacattttgcttacactttaaatgcgctttctatgcaagcgcaacaatacatttcttcg
cccctaaccgtggccaaaatgacgcaatatttagaaattgatcatgtggatagcgtgcta
gaaattggctgcgggagcggctatcaagcggcggttttgtctcaaattttcaggcgcgtt
tttagcattgaaaggattgaaagcctgtatatagaagcgcgtttgcgccttaaaactctc
ggtttaaacaatgtccatgttaaattcgctgacgggaataagggctgggagcaatacgcc
ccctatgataggattttgttttctgcttgcgctaaaaatatccctcaagcgctcattgat
cagcttgaagaaggcgggatattagtcgcgcccattcaagaaaataacgagcaagtgatc
aaacgctttgtgaagcaaaataacgccttgcgcgtccaaaaagtgttagaaaaatgcttg
tttgtgcctgttgtagatggggtgcaataa

DBGET integrated database retrieval system