KEGG   Helicobacter pylori 35A: HMPREF4655_21292Help
Entry
HMPREF4655_21292  CDS       T01892                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00010  Glycolysis / Gluconeogenesis
hpo00052  Galactose metabolism
hpo00500  Starch and sucrose metabolism
hpo00520  Amino sugar and nucleotide sugar metabolism
hpo00521  Streptomycin biosynthesis
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
hpo01120  Microbial metabolism in diverse environments
hpo01130  Biosynthesis of antibiotics
hpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF4655_21292 (glk)
   00052 Galactose metabolism
    HMPREF4655_21292 (glk)
   00500 Starch and sucrose metabolism
    HMPREF4655_21292 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF4655_21292 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF4655_21292 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HMPREF4655_21292 (glk)
Enzymes [BR:hpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF4655_21292 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADU41372
UniProt: E6S319
Position
1300469..1301479
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPTYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcacgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattttatctttctaaatgcaaagaaagccttaaa
ctgcaccctacttatggctcttttgcggtggctacgcccattatgggagattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttgaatttaaaa
aaattgcttgtcatcaacgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaatagcgatggctctttaaaa
gtcttgcccggtgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattaaccttggacactttttgctccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaactccgggactt
gatggggcgggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system