KEGG   Helicobacter pylori 35A: HMPREF4655_21299Help
Entry
HMPREF4655_21299  CDS       T01892                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00010  Glycolysis / Gluconeogenesis
hpo00020  Citrate cycle (TCA cycle)
hpo00620  Pyruvate metabolism
hpo00640  Propanoate metabolism
hpo00650  Butanoate metabolism
hpo00680  Methane metabolism
hpo01100  Metabolic pathways
hpo01120  Microbial metabolism in diverse environments
hpo01130  Biosynthesis of antibiotics
hpo01200  Carbon metabolism
Module
hpo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF4655_21299 (porA)
   00020 Citrate cycle (TCA cycle)
    HMPREF4655_21299 (porA)
   00620 Pyruvate metabolism
    HMPREF4655_21299 (porA)
   00640 Propanoate metabolism
    HMPREF4655_21299 (porA)
   00650 Butanoate metabolism
    HMPREF4655_21299 (porA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF4655_21299 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HMPREF4655_21299 (porA)
Enzymes [BR:hpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HMPREF4655_21299 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADU41379
UniProt: E6S326
Position
1307279..1308502
Genome map
AA seq 407 aa AA seqDB search
MAKNIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFRIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDAVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMNASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaatattgaactacaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccatcaacg
cccattgtgcaaaattacggctcgtttaaggataatggctatattgatggcgaatttgtt
ttagtggagtctgaacatgccgccatgagtgcatgcgtgggagctgcagcagctggggga
agggtcagcactgcgactagctcccaaggtttggcgttaatggtagaagttttataccag
gcttctggcatgcgtttgcctatcgttttgaatctagtcaatcgcgctttagcagcccct
ttgaatatccatggcgatcattctgatatgtatttgagtagagattctggctggataagt
ttatgcacatgcaacccccaagaagcttatgatttcactttaatggcgtttagaatcgca
gagcatcaaaaggtgcgcgtgcccactattgtcaatcaagatggctttttatgctcgcac
accgtgcaaaatgtccgccctttgagcgatgcagtggcttaccaattcgtaggcgaatac
caaaccaagcattcccttttggattttgataagccggtaagctatggcgcgcaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgaacgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcaccggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tcagcgatcgtagcggctaaagaaatgcgtaaaaagggcattaaggccggcgtggcgact
atccattccttgcgccccttcccttatgaaagattagggcaggatttgaaaaaccttaaa
gctttagcgattttagataagagctctccagcgggtgctatgggggcgatgtttaatgaa
gtaacgagtgcggtgtatcaaacgcaagggactaaacaccccgtggtgtctaactatatc
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgaaatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system