KEGG   Helicobacter pylori 35A: HMPREF4655_21423Help
Entry
HMPREF4655_21423  CDS       T01892                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpo  Helicobacter pylori 35A
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF4655_21423 (folP)
Enzymes [BR:hpo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HMPREF4655_21423 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439006..1440148
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALKKIGPEAIAQTHMHKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKKPFYDGVLIVSASQLERLIVKCHSQPFGLKNLAQELKSHLKAPKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEKIYQLLEKGITLIDIGAASSRPQSEIIDPKIEQDR
LKEILLEIKSQKLYQCAKFSIDTYHATTAQMALEHYFSILNDVSGFSSIKMLEVARDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLGLHLMALQNGASILRV
HDIDEHIDLIKAFKSLEETD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaaccctgatgcgctcaaaaacgctttaaaaaaaataggcccg
gaagcgatcgcgcaaacccatatgcataaaaagggcgttagctttgtttttgaaatccag
catctgcccttaagcgccacgctcattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaaaagcctttttatgatggggtgttgatt
gtgagcgctagccagttggaacgccttattgtcaagtgccattcccaaccctttgggctt
aaaaatttagcacaagaattaaaaagccaccttaaagccccaaaacctaacaacccgcag
atcatggcaattttgaatctcacgccggatagtttttatgaaaaaagccggtttgatagc
aaaaaagcgcttgaaaaaatctatcaattattagaaaagggtatcacgctcattgatata
ggcgcagcgagttcaaggccgcagagtgaaatcattgatccaaaaatagagcaagatcgc
ttaaaagaaattttattagagatcaaatcccaaaaactctaccaatgcgctaaattcagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttagtagtattaaaatgctagaagtcgccagagattacaagccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatctgtttgatgaaatggatcgcttctttaaggaaaaattagaggttttagaaaaa
tacgcgcttcaagatattattttagatattgggtttgggttcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gctggcactttgggtttgcatttaatggcgttacaaaacggagcgagtattttaagagtg
catgacattgatgagcatatagacctcatcaaggcgtttaagagtttggaagaaacagat
tga

DBGET integrated database retrieval system