KEGG   Helicobacter pylori 35A: HMPREF4655_21467Help
Entry
HMPREF4655_21467  CDS       T01892                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00010  Glycolysis / Gluconeogenesis
hpo00030  Pentose phosphate pathway
hpo00051  Fructose and mannose metabolism
hpo00052  Galactose metabolism
hpo00230  Purine metabolism
hpo00500  Starch and sucrose metabolism
hpo00520  Amino sugar and nucleotide sugar metabolism
hpo00521  Streptomycin biosynthesis
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
hpo01120  Microbial metabolism in diverse environments
hpo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF4655_21467
   00030 Pentose phosphate pathway
    HMPREF4655_21467
   00051 Fructose and mannose metabolism
    HMPREF4655_21467
   00052 Galactose metabolism
    HMPREF4655_21467
   00500 Starch and sucrose metabolism
    HMPREF4655_21467
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF4655_21467
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF4655_21467
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF4655_21467
Enzymes [BR:hpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HMPREF4655_21467
    5.4.2.8  phosphomannomutase
     HMPREF4655_21467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADU41547
UniProt: E6S3Z8
Position
1482919..1484295
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRKYDKSVFVGHDARVHGRSLFEALS
TGLQSSGLKVYDLGLIPTPVAYFAAFNEIDGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDMLLNAKHEIKPLKETPKKINALEAYHRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPNGNFPNHHPDPSEAKNLQDLEQHMQENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHSLQEALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagac
gaaaagagtgcctttagtatcggcgtggagttagggaaaatcatgcgaaaatacgataaa
agcgtgtttgtagggcatgacgccagagtgcatgggcgatcgctttttgaagctttgagc
accgggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagatggtatccaatgccccaattccatcatgatc
actggctcccacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacatgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaaatcaatgccctagaagcgtatcatcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctaatgggaatttccctaaccaccacccagatcctagcgaagcgaaa
aacttacaagatttagaacaacacatgcaagaaaacgctattttgataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaagatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgttattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcatagcctgcaagaagcgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgtgcaagcaacaccaccccgtatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagaatataaaagggcattgctcaatttgctagagaaataa

DBGET integrated database retrieval system