KEGG   Helicobacter pylori 35A: HMPREF4655_21467Help
Entry
HMPREF4655_21467  CDS       T01892                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpo  Helicobacter pylori 35A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF4655_21467 (algC)
   00030 Pentose phosphate pathway
    HMPREF4655_21467 (algC)
   00051 Fructose and mannose metabolism
    HMPREF4655_21467 (algC)
   00052 Galactose metabolism
    HMPREF4655_21467 (algC)
   00500 Starch and sucrose metabolism
    HMPREF4655_21467 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF4655_21467 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF4655_21467 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF4655_21467 (algC)
Enzymes [BR:hpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HMPREF4655_21467 (algC)
    5.4.2.8  phosphomannomutase
     HMPREF4655_21467 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1482919..1484295
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRKYDKSVFVGHDARVHGRSLFEALS
TGLQSSGLKVYDLGLIPTPVAYFAAFNEIDGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDMLLNAKHEIKPLKETPKKINALEAYHRYLIKDFEHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPNGNFPNHHPDPSEAKNLQDLEQHMQENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHSLQEALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagac
gaaaagagtgcctttagtatcggcgtggagttagggaaaatcatgcgaaaatacgataaa
agcgtgtttgtagggcatgacgccagagtgcatgggcgatcgctttttgaagctttgagc
accgggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagatggtatccaatgccccaattccatcatgatc
actggctcccacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaagctttaaaagacatgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaaatcaatgccctagaagcgtatcatcgctatttg
atcaaggattttgagcatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctaatgggaatttccctaaccaccacccagatcctagcgaagcgaaa
aacttacaagatttagaacaacacatgcaagaaaacgctattttgataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaagatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgttattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcatagcctgcaagaagcgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaataatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgtgcaagcaacaccaccccgtatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagaatataaaagggcattgctcaatttgctagagaaataa

DBGET integrated database retrieval system