KEGG   Helicobacter pylori 35A: HMPREF4655_21471Help
Entry
HMPREF4655_21471  CDS       T01892                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hpo  Helicobacter pylori 35A
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF4655_21471 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF4655_21471 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF4655_21471 (trpB)
Enzymes [BR:hpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF4655_21471 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1485824..1487005)
Genome map
AA seq 393 aa AA seqDB search
MNKKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFHLLEDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKKRIIAETGAGQHGVATAIA
CALLGLKCVIFMGAKDIKRQEMNVFRMRLLGAEIREINSGSATLKDAVNEALRDWASSYK
DTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGVFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIIESHSISA
GLDYPGVGPEHSYLKESARAIYESASDLEALEAFSLLCQKEGIIPALESSHALAHALKLA
QKCEEESIIVVNLSGRGDKDLSTVYNALKGGLK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaagcgtattttggggagtttggagggagttttgtttcagaattgttagtg
cctgcattaagagaattagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagaatatttccatcttttagaagattttgtgggccgtcctagccctttaaccttgtgt
caaaatatcgtttctaaccctaaagttaagctttatctaaaacgagaagatttaatccat
ggcggagcgcataagactaatcaagccttagggcaagcccttttagcgaaaaaaatgggt
aaaaaaaggattattgctgaaacaggcgccggtcagcatggcgtggcgacggctatcgct
tgcgcgttgttgggtttaaaatgcgtgatttttatgggggctaaagacatcaaacgccag
gaaatgaatgtttttagaatgcgcttattaggcgctgaaataagagagattaattcaggg
agcgcgacgcttaaagacgccgtgaatgaggccttaagggattgggcgagcagttacaag
gacacgcattatttgctaggcacagccgccggaccacacccttaccctacgatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttgcctgattatgttatcgcatgcgttggaggggggtctaacgctataggggtatttagc
gcgtttttaaacgacaaagaggttaaactcataggcgtagagccagcgggtttagggcta
gaaaccaataagcatggggcgactttaaataaggggcgtgtggggattttgcatgggaat
aagacctatcttttacaagatgatgaaggtcagattatagaaagccatagcattagcgcc
gggcttgattatccgggagtggggccagaacacagctatttaaaagaaagcgctcgtgcg
atttatgaaagcgcaagtgatcttgaagcgctagaagcctttagtttgttgtgccaaaaa
gaaggcattatcccggcactagaaagctcacacgctttagcgcatgctttaaaactcgct
caaaaatgcgaagaagaaagcattattgtagtgaatttaagcggtcgtggggataaggat
ttaagcaccgtttataacgctttaaaaggaggtttaaaatga

DBGET integrated database retrieval system