KEGG   Helicobacter pylori 35A: HMPREF4655_21472Help
Entry
HMPREF4655_21472  CDS       T01892                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpo  Helicobacter pylori 35A
Pathway
hpo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpo01100  Metabolic pathways
hpo01110  Biosynthesis of secondary metabolites
hpo01130  Biosynthesis of antibiotics
hpo01230  Biosynthesis of amino acids
Module
hpo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF4655_21472 (trpC)
Enzymes [BR:hpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HMPREF4655_21472 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HMPREF4655_21472 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADU41552
UniProt: E6S403
Position
complement(1487007..1488365)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSVLKKNHTLPTNINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKITKTYEKFASCISVLADSKYFLGSYENIKMVSQHSIKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLAEVSNQQEIKRLLKLQYDIIGI
NNRDLHTLKTDIDHTLKLRPLLPKDALIISESGIYSHVQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRHIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKAVQLYGYSQQEIAQLKKSLPKTCAIWQVVSVMS
ANDLASKVKEASLILYDTKGDKMGGNGVSFDWGILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLETSPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtttctgtgcttaaa
aaaaatcacactttaccgacaaacataaacccaagcgacagggattttaaaaaggcgtta
ctggaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttgaaaataaccaaaacttatgaaaaattcgcctcttgt
atttcggttttagccgattctaaatattttttaggctcttatgaaaacattaagatggtt
tcgcaacattccattaagcccattttatgcaaagattttatcattgacgcttttcaaatc
aaactcgctagaatgatgggggctaatgcagtgcttttaatgttaagcgtattagatgat
aaaaattatttagagcttttcaacctcgctaaatccttaaacatgagcgtgctggctgaa
gtttctaaccagcaagaaatcaagcgcttgctcaaactccaatacgacattatcggcatc
aataacagggatttacacaccttaaaaaccgatattgatcacacgctcaaattacgcccc
cttttgcctaaagacgcgctcattatcagcgagtccggtatttattcgcatgtgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggcagctctttaatgaaagaaaag
gatttgaaaaaagcgtgtattaaattgattttaggcgaaaataaagtgtgcgggcttaca
agaattaaagacgctaaagccgtttataaaaaccattttatttatggaggtttgattttt
gaaaaatcttcgccaagacacatcaagcctaaagaagccctaaagatcacaaaagcggtt
aaaaaattggattttgtgggcgtgtttgtgaaagataagattaaaaaaattcaaaaaatc
gctaaaaagcttgatttaaaagcggtgcagctttatggctattcacaacaagaaatcgct
caattaaaaaaatcgctccctaaaacttgtgcgatttggcaagtagtgagtgtgatgagc
gctaacgatttagcgtctaaagttaaagaagcttctctaatcttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattggggtattttagaaaatgtcaaaacg
cctttcatgttagctggcgggcttaatttggataatattcaaaaagccttgaaggttaaa
gcgttgggtttggatttcaattcaggtttagaaacaagccctgggattaaaaataaggat
aaaatcaagcgattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system