KEGG   Helicobacter pylori P12: HPP12_0100Help
Entry
HPP12_0100        CDS       T00786                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpp  Helicobacter pylori P12
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPP12_0100 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPP12_0100 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPP12_0100 (thrC)
Enzymes [BR:hpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPP12_0100 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(101617..103071)
Genome map
AA seq 484 aa AA seqDB search
MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDCLNLSYNELVECVFERL
GLEIPKGLLTDALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGVSGDFDDAQNALKNLLKDDDFSEALKTHQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTFSPAMDILKSSNVERALFDLFGFERTLELMQALEEEKFYALKPKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
STTLLALNEQKKDDKTALEVLKNSYNTPDSQRLDDLFERGIKHQEVLKLNEIKSSILLWL
ESLH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgtccccacccgttctttgaaagaaaaaaagattgattttattgaagcaata
ttaaaccccaacgcccccaaaggcgggctttacactttagagcattttgaaacattagaa
tggcaagattgtttgaatctgagctataacgagctagtggaatgcgtgtttgagcggttg
ggtttagagattcctaagggtttattgacagacgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcgctcaatgaaaggctttttgtccaagagctc
taccatgggcctagcttggcgtttaaagacatggcgttacagcctttagcgagcttgttt
tctaacctagcggtagggaaaaatgaaaagtatttaatgctcgtttctaccagtggggat
accggccctgcgactttagaaagtctggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttggggtgagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgacgattttagcgaagccctaaaaacgcaccaattgaaattaagcgtg
gctaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggggcgatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggtttgaatatt
gctaaaatcaaggtcgtaaccaacagcaatgatgttttaagggagtttatagagacaggg
cgttacgatttaacccaccgttctttaaagcaaactttctcaccggctatggatatttta
aaaagctctaatgtggaaagggcgctttttgatctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttatgccttaaaacctaaagaattagccctt
ttacaggagcatttttcttgcgcgagctgctcagatgaagcctgtttgaaaacaatccaa
gaagtttatgcagagcaccaatacctgattgatccccacaccgccaccgctttaaacgcc
agcttgaaaaccaacgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agcaccacccttttagccctaaacgagcaaaaaaaagacgataaaaccgccctagaagtg
ctaaaaaacagctacaataccccggatagccaacgccttgatgacttgtttgaaagaggg
atcaaacaccaagaagttttaaaactcaatgagatcaaatcttctattcttttgtggtta
gaaagcctacattaa

DBGET integrated database retrieval system