KEGG   Helicobacter pylori P12: HPP12_0195Help
Entry
HPP12_0195        CDS       T00786                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00010  Glycolysis / Gluconeogenesis
hpp00051  Fructose and mannose metabolism
hpp01100  Metabolic pathways
hpp01110  Biosynthesis of secondary metabolites
hpp01120  Microbial metabolism in diverse environments
hpp01130  Biosynthesis of antibiotics
hpp01200  Carbon metabolism
hpp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPP12_0195
   00051 Fructose and mannose metabolism
    HPP12_0195
   00562 Inositol phosphate metabolism
    HPP12_0195
Enzymes [BR:hpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HPP12_0195
Exosome [BR:hpp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HPP12_0195
  Exosomal proteins of bladder cancer cells
   HPP12_0195
  Exosomal proteins of melanoma cells
   HPP12_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACJ07355
UniProt: B6JPU4
Structure
PDB: 

Jmol
Position
198115..198819
Genome map
AA seq 234 aa AA seqDB search
MTKIAMANFKSAMPIFKSHAYLKELEKTLKPQHFDRVFVFPDFLGLLPNSFLHFTLGAQN
AYPRDCGAFTGEITSKHLEELKIHTLLIGHSERRTLLKESPSFLKEKFDFFKDKNFKIVY
CIGEDLTTREKGFRAVKEFLSEQLENIDLNYSNLIVAYEPIWAIGTKKSASLEDIYLTHG
FLKQILNQKTPLLYGGSVNVQNAKEILGIDSVDGLLIGSASWELENFKTIISFL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattgccatggctaattttaaatccgctatgcctatttttaaaagccatgcg
tatttaaaagaattagaaaaaactttaaaaccgcagcattttgatagggtgtttgtattc
cctgattttttggggttattgcctaattcgtttttgcatttcactttaggagcgcaaaac
gcttaccctagagattgtggggcttttactggtgaaatcacttcaaagcatttagaagaa
ctcaaaatccacacgcttttaatagggcatagcgagaggcgaacgcttttaaaagaaagc
cctagctttttgaaggaaaagtttgatttttttaaagataaaaattttaaaattgtctat
tgtattggcgaagatttaacgaccagagaaaagggttttagggctgtaaaggaattttta
agcgagcaattagaaaatattgatcttaattattccaatttaattgtggcgtatgagcct
atttgggcgattggcaccaaaaaaagcgcttctttagaagatatttatctcacgcatggt
tttttaaaacaaatcttaaatcaaaaaacgcccttgttgtatggggggagcgtgaatgtg
caaaacgctaaagaaattttagggattgatagcgtggatggcttattgattgggagtgcg
tcttgggaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system