KEGG   Helicobacter pylori P12: HPP12_0231Help
Entry
HPP12_0231        CDS       T00786                                 

Definition
disulphide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpp  Helicobacter pylori P12
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238193..238990
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLSNIFFSNKSEDVKLVAETNQKIQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagagatcaaacctttaaaatccagtcaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatatcccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcaacatattctttagcaataaaagcgaagat
gtgaaattagtcgcagaaactaatcaaaaaatccaagcccttaacgccacccaacaaaat
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgcaaataaggataaaatcctttatattgtctctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttaaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcggctaaaaaagcggctttgattcaagaagaa
atggcgaaagctagggctagaggagcgagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggcgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system