KEGG   Helicobacter pylori P12: HPP12_0275Help
Entry
HPP12_0275        CDS       T00786                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpp  Helicobacter pylori P12
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPP12_0275
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPP12_0275
Enzymes [BR:hpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPP12_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
281276..281833
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLETLLK
ENTHTDCVIVNFKGLYEIGAPSVFDLEVLGLLPRHASSLIVHEDFFISHYQLLESLVQGS
DGVVLDEELLREDLKGMVEFSWRLGLGVFVETHKSDYTHLKDLGVLGVLENSPNSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaaccaaagattgtgtttttgtaacccctgatgaggttttagaaacgcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttgttgccccgtcatgcgagctctttgata
gtccatgaggatttttttatcagccactaccagcttttagaatcgcttgttcaaggctct
gatggggtcgttttagatgaagagcttttgagagaagatttaaagggcatggtagaattt
tcttggcgtttgggcttaggcgtgtttgtagaaacccacaagtccgattatactcattta
aaagatttaggggttttaggcgtgctagaaaatagccccaattctcaaaatcaaaaaaaa
atagtctttttagattga

DBGET integrated database retrieval system