KEGG   Helicobacter pylori P12: HPP12_0275Help
Entry
HPP12_0275        CDS       T00786                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpp01100  Metabolic pathways
hpp01110  Biosynthesis of secondary metabolites
hpp01130  Biosynthesis of antibiotics
hpp01230  Biosynthesis of amino acids
Module
hpp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPP12_0275
Enzymes [BR:hpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPP12_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DUF1938
Motif
Other DBs
NCBI-ProteinID: ACJ07433
UniProt: B6JKK5
Position
281276..281833
Genome map
AA seq 185 aa AA seqDB search
MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQTKDCVFVTPDEVLETLLK
ENTHTDCVIVNFKGLYEIGAPSVFDLEVLGLLPRHASSLIVHEDFFISHYQLLESLVQGS
DGVVLDEELLREDLKGMVEFSWRLGLGVFVETHKSDYTHLKDLGVLGVLENSPNSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatagggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctgggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaaccaaagattgtgtttttgtaacccctgatgaggttttagaaacgcttttgaaa
gaaaacacccacaccgattgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttagggttgttgccccgtcatgcgagctctttgata
gtccatgaggatttttttatcagccactaccagcttttagaatcgcttgttcaaggctct
gatggggtcgttttagatgaagagcttttgagagaagatttaaagggcatggtagaattt
tcttggcgtttgggcttaggcgtgtttgtagaaacccacaagtccgattatactcattta
aaagatttaggggttttaggcgtgctagaaaatagccccaattctcaaaatcaaaaaaaa
atagtctttttagattga

DBGET integrated database retrieval system