KEGG   Helicobacter pylori P12: HPP12_0408Help
Entry
HPP12_0408        CDS       T00786                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokina se
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpp  Helicobacter pylori P12
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hpp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
422283..422774
Genome map
AA seq 163 aa AA seqDB search
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
IYINPPFGYTNQPNFYNATIILKTSLSLRHFFALVFYIERRFGRQRKRDFKDAPRTLDID
IIAFNQVILRQNDLALPHPKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactaaccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggttgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttgtattttaaaaatcatagtaaaatcggaaaaattttttcttcgccc
atttatatcaatccgccctttggttacactaatcaacccaacttttataacgctacgatt
atccttaaaacatctttaagtttacgccatttttttgctctggttttttatatagaaagg
cgttttggccgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaaccaagtcattttaagacagaatgatttggctttacctcatcctaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattcttttcaaaaaa
ggggagtggtga

DBGET integrated database retrieval system