KEGG   Helicobacter pylori P12: HPP12_0408Help
Entry
HPP12_0408        CDS       T00786                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokina se
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpp  Helicobacter pylori P12
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPP12_0408 (folK)
Enzymes [BR:hpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPP12_0408 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
422283..422774
Genome map
AA seq 163 aa AA seqDB search
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
IYINPPFGYTNQPNFYNATIILKTSLSLRHFFALVFYIERRFGRQRKRDFKDAPRTLDID
IIAFNQVILRQNDLALPHPKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactaaccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttagggttgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttgtattttaaaaatcatagtaaaatcggaaaaattttttcttcgccc
atttatatcaatccgccctttggttacactaatcaacccaacttttataacgctacgatt
atccttaaaacatctttaagtttacgccatttttttgctctggttttttatatagaaagg
cgttttggccgccaaaggaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaaccaagtcattttaagacagaatgatttggctttacctcatcctaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattcttttcaaaaaa
ggggagtggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system