KEGG   Helicobacter pylori P12: HPP12_0507Help
Entry
HPP12_0507        CDS       T00786                                 

Gene name
pldA
Definition
outer membrane phospholipase A1 precursor
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hpp  Helicobacter pylori P12
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hpp00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:hpp00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hpp00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hpp00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530815..531882
Genome map
AA seq 355 aa AA seqDB search
MKSILLFMIFVVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNAWYLPPQKAPK
EHFWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTNWFQIYNDPQSAPMRMMNFMPELIYVYPINFKPFGGKIGNFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGQPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDIFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcattttgctctttatgatttttgtagtttgtcagttagaaggcaaaaaattt
tcacaagataattttaaggtggattataactactatttgcgcaaacaggatttgcacatc
atcaaaacgcaaaacgatttgtccaatgcctggtatctccctccacaaaaagcccccaaa
gaacatttttgggtggattttgctaaaaaatatttaaacatgatggattatctaggcact
tactttctgcctttttatcatagtttcacccccatttttcaatggtaccaccccaatatc
aacccgtatcaacgcaatgagtttaagttccaaatcagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctgtatttggcttatacccaaactaactggtttcaa
atttataatgacccccaatccgctcccatgcgaatgatgaatttcatgcctgaactcatc
tatgtttatcctattaattttaaaccttttgggggtaagatagggaatttttctgaaatt
tggataggttggcagcacatttctaatggcgtggggggtgcgcagtgttaccagcctttt
aataaagaaggtaatcctgaaaaccaattcccaggacaacctgtgatcgttaaagattat
aacgggcaaaaagacgtgcgctgggggggttgtcgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggtttgaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccaaccctaatttgattgattatatggggtatggtaacgctaaa
gttgattacaggagagggcgccatcattttgaattgcaactttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaac
ccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttgtatgaatac
gatattttttccaatcgtataggggtaggaatacgcttgaacccttaa

DBGET integrated database retrieval system