KEGG   Helicobacter pylori P12: HPP12_0599Help
Entry
HPP12_0599        CDS       T00786                                 

Gene name
res-1
Definition
type III R-M system restriction enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hpp  Helicobacter pylori P12
Brite
Enzymes [BR:hpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     HPP12_0599 (res-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
628179..631121
Genome map
AA seq 980 aa AA seqDB search
MIFEKQDYQQECIHNIITLLDGFDFKCHDALNLKDCLSQFHAACEIPVKNLSGKLNVDIL
METGTGKTFTYLNLIFALHKAYGQNKFIIFVPRKPILESVKQNIRLTKDYFYLEFKRHLK
TYTYEGVKSPSNIINHYIRNQDELSVLLLTNSAIDKEGNILNKNSENLFNTKSIFENIAD
LKPISIIDEPHLLKGEAFGKYFGKIGVLYFRFGATFAKEKEHALSNVAFCLDSISAFRNY
LVKQIRIHSVMQDAQSPFLLNADSKSAKIAFYKAGILKQITLSKGEDLGKINTSFNGVSL
VKTTKDKAYLSDGTTLEKASYKLTQDEISTLLEKAIALHFEKEAFLFDQDIKALSLFFIP
KIEDFRQIENKGTPFIKTEFERLYKLKRASILSRENLSPSYREYLARDFDESGNLRVHQG
YFSGDSIAFNKGKKESSKENIEANDIKMILSEKEKLLSFQTPLRFIFSVWALQEGWDNPN
IFTLVKLANSTSETSRHQQVGRGLRIVLNQEGKRVTHGFLKGNDNAFYKINYLDMLVSGE
EVGFMEGLQKEIEASSFIGGGSALDRENLAKLGLNERKINQFCDALETLNAVEFDETNNA
YKIIAPICEIMQNNEERIKSFLSDEEYHAVLSAFKMAEDPTNKRDQIINANQPQEKVKIR
QNLAKEFKELWQTINAQSQLSYQNIQKNKLIESIAKAFNESHVMCEAIIFESKRYDPETN
RIITEQSSTLKIKNYANALQKEINALLLDFAKDERLPLKFTLELYNALNKEHFTNSPKKA
FKLLKGIIKDKLHENLLSCVSYGFCQNAFSNTAFDKTDPLYFEDGSPKNEIEKHKIGKYK
STQTPSQNYLYETIIYDSKIEEEVSKEGVQQAGDKRIEVFAKLPKFKIPTPYKNYEPDFA
YLLKDEKGAKIFFVCETKGYEKESDIPPDEKRKMDYAKKFFETLSQNLKNAKKEIRVVFA
TRINKQDLLSALKSALKETP
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgaaaagcaagactaccaacaagagtgtatccacaatatcatcacactttta
gacggctttgattttaagtgccacgatgccttaaatctaaaagattgtttaagtcaattt
catgctgcatgtgaaattcctgtcaaaaatttaagcggcaagcttaatgttgatatttta
atggaaacaggcacgggcaagactttcacttacttgaatttaatctttgcactccataag
gcttatgggcaaaataaattcatcatctttgtcccacgaaaacccattttggagtcggtt
aagcaaaatatccgccttacgaaagattatttttatttagaattcaaacgccacctgaaa
acctacacttatgaaggggttaaatcgccaagcaacattatcaaccattacattagaaac
caagatgaactgagtgtcttgctcctcactaacagcgcgattgacaaggagggaaacata
cttaataaaaacagcgaaaacctttttaacaccaaaagcatttttgaaaatatcgctgat
ttaaagcctatttctatcatagacgagccgcatttgcttaagggtgaagcgtttggtaag
tattttggtaaaataggtgtgctttattttcgctttggggcgacttttgccaaagaaaaa
gagcatgctttaagcaatgtagccttttgtttggattcaatcagcgcgtttagaaattac
cttgtcaaacaaatccgcatccattctgtcatgcaagatgcgcaaagcccgtttttgctc
aatgcggattcaaaaagcgcaaaaattgccttttacaaagcgggcattcttaaacaaatc
acgctttcaaaaggagaggatttaggcaaaattaacacttcttttaacggcgttagcttg
gttaaaaccaccaaagacaaggcttatttgagcgatggcactacgcttgaaaaggcttct
tataaactcacgcaagatgaaatcagcactcttttagaaaaagccattgccttgcatttt
gaaaaagaggcgtttttatttgaccaagacattaaagcgttaagcctattttttatccca
aaaattgaggattttaggcaaattgagaataaaggcacgccctttattaaaaccgaattt
gaaaggctttacaaactcaaacgcgcttcaattctatcaagggaaaatttatcgccaagc
tatagagaatatttagcgagagattttgatgagagcggtaatttacgcgtccatcaaggc
tattttagcggcgatagcatagcgttcaataaaggcaaaaaagaaagcagcaaagaaaat
attgaagccaatgacattaaaatgattttaagcgaaaaagaaaaactgctttcattccaa
acgcctttgcgttttatttttagcgtgtgggctttacaagagggttgggataatccaaac
atttttacccttgttaaactggcaaattccaccagcgaaacaagccgccatcagcaagtg
gggcgcgggttaagaatcgtgcttaatcaagagggcaagcgcgttacgcatggattttta
aaaggcaatgacaacgccttttataaaataaactaccttgatatgctagtgagtggcgaa
gaagtgggctttatggagggtttgcaaaaagagattgaagcgagtagctttattggtggt
ggcagcgcactagacagagagaatttagccaagttagggcttaatgaaagaaagatcaat
caattttgcgatgcattagaaacattaaacgccgtagaatttgacgaaacaaacaacgct
tacaaaatcattgcccctatttgcgagataatgcaaaacaacgaagaaaggataaaaagc
tttttaagcgatgaagaatatcacgccgttttaagcgcctttaaaatggctgaagatcca
accaacaagcgcgatcaaattataaacgctaaccaacctcaagaaaaagtcaaaatccgc
caaaatttagctaaggaatttaaagagttatggcaaaccatcaacgcgcaaagccaatta
agctatcaaaatatccaaaaaaacaagctgatagaatctatcgccaaagcgtttaatgaa
agccatgtgatgtgtgaggcaatcatctttgaaagcaaaaggtatgacccagaaaccaac
aggatcatcacagagcaatcaagcaccctaaaaatcaaaaactacgctaacgctttacaa
aaagaaataaacgcgcttctgcttgactttgccaaagatgagcgcttacccttaaaattc
acgcttgaactctacaacgctttaaacaaagagcattttacaaactcacccaaaaaagcc
tttaaattgcttaaaggcatcattaaagataagttgcatgaaaacttgctttcttgcgtg
agttatggattttgccaaaacgccttttctaacacggcttttgataaaaccgatccgctt
tattttgaagatggctcgcccaaaaatgagattgaaaaacacaaaataggcaaatacaaa
agcacgcaaactccaagccaaaactatctttatgagacgattatttatgattctaaaatt
gaagaagaagtgagtaaagaaggggtgcaacaagcgggagataaaagaatagaagttttt
gccaaactccctaaatttaaaatcccaacgccttataaaaactatgagcccgattttgct
tatttgcttaaagatgaaaagggtgcaaaaatcttttttgtttgcgaaaccaaaggttat
gaaaaagaaagcgatatcccaccagatgaaaagcgtaaaatggactacgctaagaaattt
tttgaaacgctatctcaaaatttaaagaacgcgaaaaaagaaatacgagtcgtttttgcc
acacgcattaacaaacaagatttattgagcgcacttaaaagcgcattaaaggaaacgcca
tga

DBGET integrated database retrieval system