KEGG   Helicobacter pylori P12: HPP12_0808Help
Entry
HPP12_0808        CDS       T00786                                 

Gene name
ribA
Definition
GTP cyclohydrolase II
Orthology
K01497  
GTP cyclohydrolase II [EC:3.5.4.25]
Organism
hpp  Helicobacter pylori P12
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    HPP12_0808 (ribA)
Enzymes [BR:hpp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     HPP12_0808 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(862931..863509)
Genome map
AA seq 192 aa AA seqDB search
MKRLEVSNQAKLPTQFGEFYIQCFREKGSNGSKDHLVVFTPNFSQNPLVRLHSECLTGDA
LGSQKCDCGGALQMALERISKEGGLVIYLRQEGRGIGLFNKVNAYALQDKGYDTIQANEM
IGFKDDERDYSVAGEILEYYRIKKMRLLTNNPKKIAALEKYAEVTRESLIVCANEHNQGY
LEVKKLKMGHLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacgattagaagtttctaaccaagccaaattacccactcaatttggggagttttat
atccaatgttttagagaaaagggttctaatggctctaaagatcatttagtggttttcacc
cctaatttttctcaaaaccccttagtgcgcctgcattcagaatgcttaacgggtgatgct
ctaggctctcaaaaatgcgattgtgggggggcgttgcaaatggcgttagaaaggatttct
aaagaaggggggctagtgatttatttgcgccaagaagggcgtgggatagggctatttaat
aaagtcaatgcctacgctttgcaagataagggctatgataccattcaagccaatgaaatg
atagggtttaaagacgatgaaagggattatagtgttgcgggtgaaattttagaatattac
cgcattaaaaaaatgcgcttactcacgaacaaccctaaaaaaatcgccgctttagaaaaa
tacgctgaggtaacaagagagagcttgatcgtgtgcgctaatgaacacaatcaagggtat
ttggaagtcaaaaagctcaaaatggggcatttattgtga

DBGET integrated database retrieval system