KEGG   Helicobacter pylori P12: HPP12_0922Help
Entry
HPP12_0922        CDS       T00786                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hpp  Helicobacter pylori P12
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985468..986049
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CSSCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLIEENIKEIIFAFPPTLANDSLMLYIEDKLQHFHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaag
atccccaatgtgggtaaaaagtccgcctttaaaatggcgtatcatttgggtttagaaaac
ccctatttggcgctcaaaatcacgcacgctttagagaacgccctagaaaaccttaaaaca
tgttcatcttgtaacgcgctcagtgagagcgaggtttgtgagatttgctctgatgaaagc
cgacaaaattctcagctttgcatggttttacacccaagagacgtgtttattttagaagat
ttaaaggattttttagggcgttattatgtgttaaattccatagaagaagtggattttaac
gccctagaaaaacgcctgattgaagaaaacattaaagaaatcatttttgctttccctccc
actttggctaatgattctctaatgctttatattgaagacaaattacagcatttccatctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactcc
gtctcgctctcaagggcgtttaattcaaggatcaaggcatga

DBGET integrated database retrieval system