KEGG   Helicobacter pylori P12: HPP12_1068Help
Entry
HPP12_1068        CDS       T00786                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00010  Glycolysis / Gluconeogenesis
hpp00052  Galactose metabolism
hpp00500  Starch and sucrose metabolism
hpp00520  Amino sugar and nucleotide sugar metabolism
hpp00521  Streptomycin biosynthesis
hpp01100  Metabolic pathways
hpp01110  Biosynthesis of secondary metabolites
hpp01120  Microbial metabolism in diverse environments
hpp01130  Biosynthesis of antibiotics
hpp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPP12_1068 (glk)
   00052 Galactose metabolism
    HPP12_1068 (glk)
   00500 Starch and sucrose metabolism
    HPP12_1068 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPP12_1068 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPP12_1068 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPP12_1068 (glk)
Enzymes [BR:hpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPP12_1068 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACJ08220
UniProt: B6JMU2
Position
1139242..1140252
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLRCEDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLTLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactcttagccgatattggcggcacaaacgcgcgc
tttggtttggaagtcgccccacgacagattgaatgcattgaagtcttgagatgcgaagat
tttgagagcttgagcgatgcggtgcgattttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgctgtggctacgcccattatgggggattttgtccaa
atgacgaacaaccattggactttttctattgaaacgacacggcaatgtttgactttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaatagcgatggctctttgaaa
gtcttacccggcgaaggagggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgctcgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaagccctgtccaaacgaaaaggcttagaaaaggtggcg
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattaaccttggacactttttgctccatgctaggcacgctcgctgcc
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcacgctttgaaacgaaagggcgc
atgggagcgtttctcgcttccatccctgtgcatgtcgtgatgaaaaaaactcccggactt
gatggggcaggcattgcgttagagaattatttactgcatgataaaatttag

DBGET integrated database retrieval system