KEGG   Helicobacter pylori P12: HPP12_1241Help
Entry
HPP12_1241        CDS       T00786                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpp  Helicobacter pylori P12
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPP12_1241
   00030 Pentose phosphate pathway
    HPP12_1241
   00051 Fructose and mannose metabolism
    HPP12_1241
   00052 Galactose metabolism
    HPP12_1241
   00500 Starch and sucrose metabolism
    HPP12_1241
   00520 Amino sugar and nucleotide sugar metabolism
    HPP12_1241
  Nucleotide metabolism
   00230 Purine metabolism
    HPP12_1241
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPP12_1241
Enzymes [BR:hpp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPP12_1241
    5.4.2.8  phosphomannomutase
     HPP12_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329617..1330993
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMRACDKSVFVGHDARVHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPEKVNALEAYQRYLIKDFQHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMRENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
IIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQKALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLSLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacatcagcatttttagagaatacgatattagaggcatttaccccaccactttagac
gaaaatacggcctttagtatcggcgtggaattagggaaaatcatgcgagcatgcgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagt
gcgggactgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaattaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaaccaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaaacgcaaagcatgaaata
aaacccctaaaagaaacgccagagaaagtcaatgccctagaagcgtatcagcgctatttg
atcaaggattttcagcatttaaaaaatcttaaatacaaaatcgctctggattttggcaat
ggcgtgggagcgttagggctagagccgattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcgagaaaacgctattttaataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgataggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaagctcaaagaaaccaacgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaagtccaagcgatttggaaaac
attattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcacaacctacaaaaagcgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgtgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacggcgttagaatataaaagggcgttactcagtttgttagagaaataa

DBGET integrated database retrieval system