KEGG   Helicobacter pylori P12: HPP12_1243Help
Entry
HPP12_1243        CDS       T00786                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpp  Helicobacter pylori P12
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPP12_1243 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPP12_1243 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPP12_1243 (trpA)
Enzymes [BR:hpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPP12_1243 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1331809..1332597)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQDKMAFIPFVTLGDPNYEWSFEIIKTLITSGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRALRDYNPHIPIGLLAYANLIFSYGVDGFYAQIKECG
VDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASVKDLEQAAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKAFSPTPALLGFGISQKEHIKNAKEMGADGVICGSALVKIIE
ENLNNENAMLEKIKGFIGGMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacaagacaaaatggcgtttatcccg
tttgtaaccttgggcgatcccaattatgaatggagttttgaaatcattaaaaccttaatc
actagcggggtgagtgctttagaattgggttttgctttttctgatcctgtggcggatggc
gttaccatacaagcgagccatttaagagcgttaaaacacgctagcatggctaaaaatttc
cagcttttaagggcgctcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttacggcgttgatggcttttacgctcaaatcaaagaatgcggc
gtggatagcgttttaatagcggacatgcccctaatagaaaaagaattagtcatcaaatcc
gctcaaaaacaccaaatcaagcaaatctttatcgctagccctaatgcgagcgttaaagat
ttagaacaagccgctatgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggggcgagccgtattttagaaaatgatgcgagcgctattatcaaaaccttaaaagcc
tttagccctacccccgcattactaggctttggcatttctcaaaaagaacacatcaaaaac
gctaaagaaatgggtgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttaaacaatgaaaacgccatgctagaaaaaattaaagggtttataggaggaatg
attttttaa

DBGET integrated database retrieval system