KEGG   Helicobacter pylori P12: HPP12_1245Help
Entry
HPP12_1245        CDS       T00786                                 

Gene name
trpC
Definition
(GenBank) bifunctional N-(5'-phospho-ribosyl)anthranilate isomerase / indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpp01100  Metabolic pathways
hpp01110  Biosynthesis of secondary metabolites
hpp01130  Biosynthesis of antibiotics
hpp01230  Biosynthesis of amino acids
Module
hpp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPP12_1245 (trpC)
Enzymes [BR:hpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPP12_1245 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPP12_1245 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACJ08397
UniProt: B6JNB9
Position
complement(1333776..1335134)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSDLKKNHALAANINPSDRDFKKALLEKKTSFILECKKASPSKGL
IRKDFDLLKIAKTYEKFASCISVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARMMGANAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNKQEIKRLLKLQYDIIGI
NNRDLHTLKTDINHTLELRPLLPKDALVISESGIYSHAQIKALAPYVNGFLVGSSLMKEK
DLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKKALKITKAV
KKLDFVGVFVKDKIKKIAKIVKKLDLKAVQLYNYSPKEIAQLKKALPKTCAIWQVISVMS
AKDLTPKIQEASLILYDTKGDKMGGNGVSFDWEILENVKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLEISPGIKNKDKIKRLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaagctcctagaagtctctgatctcaaa
aaaaatcacgctttagcggcaaacataaacccaagcgatagggattttaaaaaggcgtta
ctagaaaaaaagaccagctttattttagaatgcaaaaaagcatcgccctctaaaggttta
atcagaaaagattttgatctgttaaaaatagccaaaacttatgaaaaattcgcctcttgc
atttcggttttagccgattctaaatattttttaggctcttatgaaaacattaagattgtt
tcgcagcattccactaagcctattttatgcaaagattttatcattgatgcttttcaaatc
aaactcgctagaatgatgggggctaatgcggtgcttttaatgttaagcgtgttagatgat
aaaaattatttagagctttttaacctcgctaaatccttaaacatgagcgtgctgactgaa
gtttccaataagcaagaaatcaagcgcttgctcaaactccaatacgacattataggcatc
aataacagggatttgcacaccttaaaaaccgatattaaccacacgctagaattacgcccc
ttattgcctaaagacgcgcttgttatcagtgagtccggtatttattcgcatgcgcaaatc
aaggccctagccccttatgtgaatggctttttagtgggcagctctctaatgaaagaaaag
gatttgaaaaaagcgtgcattaaattgattttaggcgaaaataaagtgtgcgggcttaca
aggattaaagacgctaaagccgtttataaaaaccatttcatttatgggggtttgattttt
gaaaaatcttcgccccgatacatcaagcctaaaaaagccctaaagatcacaaaagcggtt
aaaaaactggattttgtgggcgtgtttgtgaaagataaaattaaaaaaatcgctaaaatc
gttaaaaagcttgatttaaaagcggtgcagctttataactattcgcctaaagaaatcgct
caattgaaaaaagcactccctaaaacttgcgcgatctggcaagtaataagcgtgatgagt
gctaaagatttaacgcctaaaattcaagaggcctctctaatcttatacgacactaaaggg
gataaaatgggaggcaatggcgtgagttttgattgggaaattttagaaaatgtcaaaacg
cctttcatgctagctggtgggcttaatttggataatattcaaaaagccttgaaagttaaa
gcgttggggttggatttcaattccggtttagaaataagccctgggattaaaaataaggat
aaaatcaagcgcttagcccgaattttaagagagtattaa

DBGET integrated database retrieval system