KEGG   Helicobacter pylori P12: HPP12_1421Help
Entry
HPP12_1421        CDS       T00786                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpp  Helicobacter pylori P12
Pathway
hpp00900  Terpenoid backbone biosynthesis
hpp01100  Metabolic pathways
hpp01110  Biosynthesis of secondary metabolites
hpp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPP12_1421
Enzymes [BR:hpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPP12_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ACJ08569
UniProt: B6JNU1
Position
1498067..1498870
Genome map
AA seq 267 aa AA seqDB search
MHAFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDVISVKSALSFSLKGDFDCPLE
ENSLFKALQILKNFLKSKNFSHSVIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHLN
QIFDWRLSLEELYTMGSLVGADTNFFISQYKSANATSYGEVIENFEEEPLENRLEIYAPN
HVFCSTKAIYQAYKPETCFSQAKEWLKKPSLECLKTCDRNGLNDLLKPALLTNQALRSIE
SELGKEWFFSGSGSAFFRLKPALKGGE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcttttgaagtttatcctaaagtcaatatttttttaaagatccttcacaaagaa
ggggcttaccacaagcttatttctcgcatgtgtttagtcaaagataagctaaaggatgtt
attagcgtcaaaagtgcgctttccttttcactaaaaggggattttgactgccctttagaa
gaaaactcgctctttaaagccctccaaattttaaagaattttttaaaatcaaaaaatttc
tctcattctgtcatcaaatccctagataccctagcgattgaagtggaaaaaaatatcccc
actcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatttaaat
cagatttttgactggcgtttgagtttagaagagctttatactatgggatctttagtgggt
gcggacaccaattttttcatctcgcaatacaaaagcgctaacgccacttcttatggcgaa
gtcattgaaaattttgaagaagaacctttagaaaatcgcctagaaatttatgcaccaaat
catgttttttgcagcaccaaagccatctatcaagcctataaacctgaaacttgtttttct
caagctaaagaatggcttaaaaagccgagtttggaatgcctaaagacttgcgaccgaaac
ggattaaacgatcttttaaaaccggctttactcactaaccaagctttaagaagtatagaa
agcgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggctaaag
cctgcgctaaaagggggcgaatga

DBGET integrated database retrieval system