KEGG   Helicobacter pylori P12: HPP12_1439Help
Entry
HPP12_1439        CDS       T00786                                 

Definition
cytochrome C551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpp  Helicobacter pylori P12
Brite
Enzymes [BR:hpp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPP12_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1516028..1517080
Genome map
AA seq 350 aa AA seqDB search
MKKSVLLGVCLAFSCAHALNDLELIKKARESQLEPMPMGKALKEYQIKKTRDVGIGAKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFGALKGKKPKILYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccgttttgttgggcgtttgcttggccttttcttgcgctcatgccctaaac
gatttagaattgattaaaaaagcgagggaaagccaattagagcctatgcctatgggcaaa
gcgctcaaagaataccaaatcaaaaaaaccagagatgtgggtattggtgctaaaaacagc
gaaatcatgacctccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ttagtcccaagcgctataggctctcaatggaagaaaaacccccaccttttaagttcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatggtagggttacgcattta
aacgaacaagcgcaagggcccatccagtcttcttttgaaatgggggctgatcctaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaagctctttagaaaagcctatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccacg
ctcattaccccaagccgttacgatgattttttaaggggtaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataatggc
atcaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccctatttccataacgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttggagccttaaagggtaaaaaacctaaaatactctatccagaactccctgta
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system