KEGG   Helicobacter pylori P12: HPP12_1513Help
Entry
HPP12_1513        CDS       T00786                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpp  Helicobacter pylori P12
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hpp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1608504..1609472)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFGKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDTKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELEIPLFSVEAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLESFKDRLKAIEVTEYNPTVSTKHTNEEEKQVLE
ILDLIINGCKIKDKKRSFAMSY
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattagaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaggctttgagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgccaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttggaaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcggat
attcacacggcttatgacagcgatacaaagcacatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagagatgtgattaaggaattagaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattactaaaagcggtggatattatttatctcagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacggactgagttttgatgagctcaag
caattactaggcttgcttttagaaagttttaaagacagattaaaagcgattgaggtaacc
gaatacaaccccacggtgagcaccaaacacaccaacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatggctgtaaaattaaagataagaagcgatcttttgcaatg
agttactga

DBGET integrated database retrieval system