KEGG   Helicobacter pylori 2017: hp2017_01031Help
Entry
hp2017_01031      CDS       T01913                                 

Gene name
thrC2a
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00260  Glycine, serine and threonine metabolism
hpq00750  Vitamin B6 metabolism
hpq01100  Metabolic pathways
hpq01110  Biosynthesis of secondary metabolites
hpq01120  Microbial metabolism in diverse environments
hpq01230  Biosynthesis of amino acids
Module
hpq_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    hp2017_01031 (thrC2a)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    hp2017_01031 (thrC2a)
Enzymes [BR:hpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     hp2017_01031 (thrC2a)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TraV
Motif
Other DBs
NCBI-ProteinID: ADZ49182
Position
complement(97362..98195)
Genome map
AA seq 277 aa AA seqDB search
MLKARQLKLSVANSVNFGRIAFQIVYHIWGFLELYKKGAINSKEKITLAIPSGNFGNALG
AFYAKKMGLNIAKIKVVTNSNDVLREFIETGRYDLTKRSLKQTYSPAMDILKSSNVERAL
FSLFGFERTLELMQALEEEKFYALKPKELALLQEHFSCASCSDEDCLKTIQEVYAEHRYL
IDPHTATALNASLKTHEKTLVSATASYEKFPRTTLLALNEQKKNDNDKAALETLKNSYNT
PDSQRLDDLFERGIKHQEVLKLNEIKSSILLWLENTH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaagcacgccaattaaaattaagcgtggctaattccgtgaattttgggcgcatc
gcttttcaaatcgtctatcatatttggggctttttggaattgtataaaaaaggggcgatc
aattctaaagaaaaaatcaccctagccatacccagcggtaattttgggaacgctctaggg
gcgttttatgccaaaaaaatgggcttgaatatcgctaaaatcaaggtcgtaaccaacagc
aacgatgttttaagggagtttatagagacaggccgttacgatttgactaagcgctcttta
aagcaaacctactcgccggctatggatattttaaaaagctccaatgtggaaagggcgctt
tttagcctttttgggtttgaacgaacgctggaattgatgcaagctttagaagaagagaaa
ttttatgccttaaagcctaaagaattagcccttttacaggagcatttttcttgcgcgagc
tgctcagatgaagattgtttgaaaaccattcaagaagtttatgcagaacaccgatacctg
attgacccccacaccgccaccgctttaaacgccagcttgaaaacccacgaaaaaaccctt
gtttctgccaccgcctcttatgaaaaattccctagaaccacccttttagccctgaatgag
caaaagaaaaacgataacgataaagccgccctagaaacgcttaaaaacagctacaacacc
ccggatagccaacgccttgatgatttgtttgaaagaggcatcaagcaccaagaagtttta
aaactcaatgagatcaaatcttctatccttttgtggttagaaaacacgcattaa

DBGET integrated database retrieval system