KEGG   Helicobacter pylori 2017: hp2017_01031Help
Entry
hp2017_01031      CDS       T01913                                 

Gene name
thrC2a
Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hpq  Helicobacter pylori 2017
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    hp2017_01031 (thrC2a)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    hp2017_01031 (thrC2a)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    hp2017_01031 (thrC2a)
Enzymes [BR:hpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     hp2017_01031 (thrC2a)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(97362..98195)
Genome map
AA seq 277 aa AA seqDB search
MLKARQLKLSVANSVNFGRIAFQIVYHIWGFLELYKKGAINSKEKITLAIPSGNFGNALG
AFYAKKMGLNIAKIKVVTNSNDVLREFIETGRYDLTKRSLKQTYSPAMDILKSSNVERAL
FSLFGFERTLELMQALEEEKFYALKPKELALLQEHFSCASCSDEDCLKTIQEVYAEHRYL
IDPHTATALNASLKTHEKTLVSATASYEKFPRTTLLALNEQKKNDNDKAALETLKNSYNT
PDSQRLDDLFERGIKHQEVLKLNEIKSSILLWLENTH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaaagcacgccaattaaaattaagcgtggctaattccgtgaattttgggcgcatc
gcttttcaaatcgtctatcatatttggggctttttggaattgtataaaaaaggggcgatc
aattctaaagaaaaaatcaccctagccatacccagcggtaattttgggaacgctctaggg
gcgttttatgccaaaaaaatgggcttgaatatcgctaaaatcaaggtcgtaaccaacagc
aacgatgttttaagggagtttatagagacaggccgttacgatttgactaagcgctcttta
aagcaaacctactcgccggctatggatattttaaaaagctccaatgtggaaagggcgctt
tttagcctttttgggtttgaacgaacgctggaattgatgcaagctttagaagaagagaaa
ttttatgccttaaagcctaaagaattagcccttttacaggagcatttttcttgcgcgagc
tgctcagatgaagattgtttgaaaaccattcaagaagtttatgcagaacaccgatacctg
attgacccccacaccgccaccgctttaaacgccagcttgaaaacccacgaaaaaaccctt
gtttctgccaccgcctcttatgaaaaattccctagaaccacccttttagccctgaatgag
caaaagaaaaacgataacgataaagccgccctagaaacgcttaaaaacagctacaacacc
ccggatagccaacgccttgatgatttgtttgaaagaggcatcaagcaccaagaagtttta
aaactcaatgagatcaaatcttctatccttttgtggttagaaaacacgcattaa

DBGET integrated database retrieval system