KEGG   Helicobacter pylori 2017: hp2017_0119Help
Entry
hp2017_0119       CDS       T01913                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00051  Fructose and mannose metabolism
hpq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    hp2017_0119
Enzymes [BR:hpq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     hp2017_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADZ49198
Position
114668..115297
Genome map
AA seq 209 aa AA seqDB search
MNTHTRGIDSGLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNEN
TLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYL
GYRSLGEEIAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKLMEV
FDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacacaagaggtattgatagcgggctgatccattcgctccaaagcatttca
ttatccatgtttagaaagggtttttttgggctttatcaaggctccatttcggcgcgcatt
ggcactaatcagtttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaac
accttactggtcttgcatgacaagatagattaccgctggaaagaagcgagcctggattcg
cccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgcttacgcacgc
cctccttatagcctagcgtattctttgcgtcataaccgattgctccctagggattattta
gggtatcgttctttgggcgaagaaatcgccatttttaaccccaaagactatgacagctgg
caagaaagagcggatacagaaattttacgccaattgcaagagagtaagaaatattttgtt
ttcattaaggggtgcgggatttttgcctaccatagggagctttctaaactcatggaagtt
tttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatggattattgc
tataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system