KEGG   Helicobacter pylori 2017: hp2017_0119Help
Entry
hp2017_0119       CDS       T01913                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpq  Helicobacter pylori 2017
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    hp2017_0119
Enzymes [BR:hpq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     hp2017_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
114668..115297
Genome map
AA seq 209 aa AA seqDB search
MNTHTRGIDSGLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNEN
TLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYL
GYRSLGEEIAIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKLMEV
FDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacacaagaggtattgatagcgggctgatccattcgctccaaagcatttca
ttatccatgtttagaaagggtttttttgggctttatcaaggctccatttcggcgcgcatt
ggcactaatcagtttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaac
accttactggtcttgcatgacaagatagattaccgctggaaagaagcgagcctggattcg
cccattcatgcgagcgtgtatcgggagtttttggacgctaaattcatcgcttacgcacgc
cctccttatagcctagcgtattctttgcgtcataaccgattgctccctagggattattta
gggtatcgttctttgggcgaagaaatcgccatttttaaccccaaagactatgacagctgg
caagaaagagcggatacagaaattttacgccaattgcaagagagtaagaaatattttgtt
ttcattaaggggtgcgggatttttgcctaccatagggagctttctaaactcatggaagtt
tttgatttgattgaaaactcatgcaaggttttacgattgggcgatttaatggattattgc
tataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system