KEGG   Helicobacter pylori 2017: hp2017_0168Help
Entry
hp2017_0168       CDS       T01913                                 

Gene name
hemB
Definition
Porphobilinogen synthase/delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpq  Helicobacter pylori 2017
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    hp2017_0168 (hemB)
Enzymes [BR:hpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     hp2017_0168 (hemB)
Exosome [BR:hpq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   hp2017_0168 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(162305..163276)
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRLRSSENLRAMLRETHLNINDFIAPLFVIESDSYIKNEISSMPGVYQMSIEPLL
KECEELVGLGIKAVLLFGIPKHKDATGSHALNKDHIVAKATKEVKKRFKDLIVIADLCFC
EYTDHGHCGILENDSVSNDKTLEILNLQGLILAESGVDILAPSNMMDGNVLSLRKTLDKA
GYFHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSYQMDYANQKEALLESLEDEKQGA
DILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYAMLKLAQKHNLINYESVLLETMTCF
KRAGADMIISYHAKEVANLLQRN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacgattgagaagattacgaagcagcgaaaatttaagagcgatgttaagagaa
acgcatttaaatatcaatgatttcatcgctcccttatttgtcatagaaagcgatagttat
attaaaaacgaaatcagctccatgcccggcgtgtatcaaatgagtatagagcctctttta
aaagaatgcgaagaattagtgggtttaggcataaaagccgttttactgtttggcattcct
aaacataaggacgctacaggaagccatgcgttaaataaggatcacattgtcgcaaaagcc
accaaagaggttaaaaaacgatttaaggatttaatcgttatagcggatttgtgtttttgc
gaatacaccgaccatgggcattgcgggattttagaaaacgattctgtgtctaacgataaa
acgctagagattttaaatcttcaagggcttattttggctgaaagcggtgtggatattcta
gccccaagcaacatgatggatggcaatgttttaagcttgaggaaaacgctagataaggcc
gggtattttcacacgcccatcatgagctattccactaaatttgcgagcagttattatggg
ccttttagagatgtagctaattctgcaccgagttttggcgatcgcaaaagctatcaaatg
gattacgctaaccaaaaagaagcgcttttagaaagcttggaagatgaaaaacagggtgcg
gatattttaatggtgaagccggctttagcgtatttggatattgttaaagagattagagat
cacactttgctccctttagcgctctataacgtgagtggggaatacgccatgctcaaactc
gcgcaaaaacacaacctgatcaactatgaaagcgttctgttagaaacgatgacttgcttt
aaaagagcgggagcggatatgattattagctaccatgctaaagaagtggctaacttatta
caaaggaattga

DBGET integrated database retrieval system