KEGG   Helicobacter pylori 2017: hp2017_0238Help
Entry
hp2017_0238       CDS       T01913                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpq  Helicobacter pylori 2017
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
231290..232087
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLIKVIEKQTNKKVRILETKPLKSNQD
LKIVVVEDPDTKYQIPLVVSKDGNLVIGLSGIFFSNNSEDVKLLTETNQKIQALNATQQN
SAKLNALFDEVPADYVIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagtgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggacaatttgattaaagtgattgaa
aaacaaaccaataaaaaggtgcgtattttagagactaaacccttgaaatccaatcaagat
ttaaaaatcgtggtggtagaagatccggacactaaataccaaatcccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcggtatcttttttagcaataatagcgaagac
gtgaagttgctcacagagaccaatcaaaaaattcaagcccttaacgctacgcaacaaaat
agcgcgaagttgaacgctctttttgatgaagtgccggctgattatgtgatagagttgccc
tctactaacgctgaaaataaggataaaatcctttatattgtctctgatcccatgtgcccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcggctaaaaaggcggctttgatccaagaagaa
atggcgaaggctagggctaggggagcgagcgtggaagataagatctctattcttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggcgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system