KEGG   Helicobacter pylori 2017: hp2017_1054Help
Entry
hp2017_1054       CDS       T01913                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00010  Glycolysis / Gluconeogenesis
hpq00052  Galactose metabolism
hpq00500  Starch and sucrose metabolism
hpq00520  Amino sugar and nucleotide sugar metabolism
hpq00521  Streptomycin biosynthesis
hpq01100  Metabolic pathways
hpq01110  Biosynthesis of secondary metabolites
hpq01120  Microbial metabolism in diverse environments
hpq01130  Biosynthesis of antibiotics
hpq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp2017_1054 (glk)
   00052 Galactose metabolism
    hp2017_1054 (glk)
   00500 Starch and sucrose metabolism
    hp2017_1054 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    hp2017_1054 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    hp2017_1054 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    hp2017_1054 (glk)
Enzymes [BR:hpq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     hp2017_1054 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADZ50164
Position
1074032..1075042
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECVEVLRCEDFESLSDAVRFYLSKCKESLK
LRPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVMKKTPGLDGAGIALENYLLHDRI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacaaacgcgcgc
tttggtttggaagtcgccccacgacagattgaatgtgttgaagtcttgaggtgcgaagat
tttgaaagcttgagcgatgcggtgcggttttacctttctaaatgcaaagaaagccttaaa
ctgcgccctatttatggctcttttgctgtggctacgcccatcatgggggattttgtccaa
atgacgaacaaccactggactttttctattgagacgacacggcaatgtttgaatttaaaa
aaactgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgagatcaacgcccctaaagcgatttta
gggccaggaaccgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttacccggtgaaggggggcatgtgagctttgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggcttggtgctgatttatgaagctttatccaaacgaaaaggcttagaaaaagtggcg
aaattgagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgaccttggacactttttgctccatgcttggcacgctcgctgct
gatgtggccctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggggcgtttctcgcttccatccctgtgcatgtcgtgatgaaaaaaactcccggactt
gatggggcgggcattgcgttagaaaattatttactgcatgatagaatttag

DBGET integrated database retrieval system