KEGG   Helicobacter pylori 2017: hp2017_1178Help
Entry
hp2017_1178       CDS       T01913                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpq  Helicobacter pylori 2017
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    hp2017_1178 (hemD)
Enzymes [BR:hpq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     hp2017_1178 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1204407..1205069
Genome map
AA seq 220 aa AA seqDB search
MHSQRIAPYKTLILNELCYYPLELDLTPFNALIFTSKNAVFSLLKTLKNSPKLKILQNIP
AYALSEPTAKTLQDHHFKTAFIGEKAHGKEFAQEILPLLEKKSVLYLRAKEIASSLDAIL
LEHGINFQQAVVYENKLKHLTLSEQNALKPQEKSVLIFTAISHAKAFLHYFEFLKSYTAI
SIGNTTALYLQEQGIQSYIAQKPSLEACLELALNLRVKEC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgcattctcaaagaatcgccccttataaaactctcattttaaatgaattatgctactat
cctttagaattggatttaaccccttttaacgccctgattttcacttctaaaaatgcggtg
ttttccttgctaaaaaccctaaaaaacagccccaaactcaaaattttacaaaacattcct
gcttacgctttgagcgaacccaccgcaaaaactctacaagatcaccattttaaaaccgcc
tttataggggaaaaagcccatggcaaagagtttgctcaagaaatccttcctttattggaa
aaaaaaagcgttttgtatctcagggcaaaagaaattgcctcttctttagacgctattctt
ttagagcatggcatcaatttccaacaagccgttgtttatgaaaacaagctcaaacatttg
actttaagcgagcaaaacgccctaaaaccccaagaaaagagcgttcttattttcaccgcc
ataagccatgcgaaagcctttttacactattttgaatttttaaaaagttacaccgccata
agcattggcaacacgaccgctctttatttacaagaacaaggcattcaaagctatatagct
caaaagccctccttagaagcatgtttagaactggctttaaatttgagagttaaggaatgt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system