KEGG   Helicobacter pylori 2017: hp2017_11862Help
Entry
hp2017_11862      CDS       T01913                                 

Definition
Dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpq  Helicobacter pylori 2017
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    hp2017_11862
Enzymes [BR:hpq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     hp2017_11862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1210232..1211170
Genome map
AA seq 312 aa AA seqDB search
MAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKDLAQELKSHLKAPKPNTPQIMAVLNLT
PDSFYEKSRFSSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEVLLEI
KSQKLYQCAQFSIDTYHAQTAQMALEHCFSILNDVSGFNSIEMLEVARDYKPTCVLMHTQ
KTPKDMQENVFYRNLFDEMDRFFKDKLEVLEKYALQDIILDIGFGFAKLKEHNLALIKHL
SHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRAHDIDEHID
LIKVFKSLEETD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagagcctttttatgatggggtgttgattgcgagcgctaagcaattagaacgc
cttattgtgaagtgccattcccaaccctttgggcttaaagatttagcgcaagaattaaaa
agccacctcaaagcccccaagcctaacaccccacaaatcatggcggttttgaatctcacg
ccggatagtttctatgaaaagagccgttttagtagcaaaaaagcgcttgaagaaatctat
caatggctagaaaagggtatcacgctcattgatataggcgcggccagttcaagaccgcag
agtgaaatcattgatcccaaagtagagcaagatcgcttgaaagaagttttattagagatc
aaatcccaaaaactctaccagtgtgcccaattcagcatagacacctaccatgcccaaacc
gcccaaatggctttggagcattgtttttctatccttaatgacgtgagcggttttaatagc
attgaaatgctagaagtcgcacgagattacaagcccacttgcgttttaatgcatactcaa
aaaacccccaaagacatgcaagaaaatgttttttaccgcaatctgtttgatgaaatggat
cgcttttttaaggacaaactagaggttttagaaaaatatgcgcttcaagatattatttta
gatattgggtttggattcgctaaattaaaagagcataatctagctttaatcaagcactta
agccattttcttaagttcaaaaaacccctattggtaggagcgagccgtaaaaacacgatc
gggcttatcactgggcgtgaagttcaaaaccggctcgctggcactttaagtttgcattta
atggcactacaaaatggggcgagtattttaagagcgcatgatattgatgagcatatagat
ttaatcaaggtgtttaagagtttggaagaaacggattga

DBGET integrated database retrieval system