KEGG   Helicobacter pylori 2017: hp2017_1233Help
Entry
hp2017_1233       CDS       T01913                                 

Definition
(GenBank) Phosphomannomutase / Phosphoglucomutase/Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpq  Helicobacter pylori 2017
Pathway
hpq00010  Glycolysis / Gluconeogenesis
hpq00030  Pentose phosphate pathway
hpq00051  Fructose and mannose metabolism
hpq00052  Galactose metabolism
hpq00230  Purine metabolism
hpq00500  Starch and sucrose metabolism
hpq00520  Amino sugar and nucleotide sugar metabolism
hpq00521  Streptomycin biosynthesis
hpq01100  Metabolic pathways
hpq01110  Biosynthesis of secondary metabolites
hpq01120  Microbial metabolism in diverse environments
hpq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    hp2017_1233
   00030 Pentose phosphate pathway
    hp2017_1233
   00051 Fructose and mannose metabolism
    hp2017_1233
   00052 Galactose metabolism
    hp2017_1233
   00500 Starch and sucrose metabolism
    hp2017_1233
   00520 Amino sugar and nucleotide sugar metabolism
    hp2017_1233
  Nucleotide metabolism
   00230 Purine metabolism
    hp2017_1233
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    hp2017_1233
Enzymes [BR:hpq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     hp2017_1233
    5.4.2.8  phosphomannomutase
     hp2017_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADZ50347
Position
1252420..1253796
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMREYDKSVFVGHDARVHGRFLFEALS
AGLQSSSLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEKKPLKETPKKVNALEAYHRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMRENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQEALKNPPSHFPTIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETIALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgacattaggggcatttaccccaccactttagat
gaaaatacggcttttagtatcggcgtggagttggggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcagcctgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatcaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggacattcaggctttaaaagacacgcttttaaatgctaaacatgaaaaa
aaacccctaaaagaaacgccaaagaaagtcaatgccctagaagcgtatcatcgctatttg
atcaaggattttaagcatttaaaaaatcttaaatataaaatcgccctggattttggtaat
ggcgtgggagcgttaggattagagccgattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcgagaaaacgctattttgataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccttttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaagctcaaagaaactaatgcacattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tacgcatgtttaagggctttggagttattgcttgaacaaagtccaagcgacttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcacaacttacaagaagcgcttaaaaacccgccaagccat
ttccctacaatcaaagaaatcatcagcattgatggcgtgagagtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaatagcgttagaatataaaagggcgttgctcaatttgttagagaagtag

DBGET integrated database retrieval system