KEGG   Helicobacter pylori 2017: hp2017_1395Help
Entry
hp2017_1395       CDS       T01913                                 

Definition
putative cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpq  Helicobacter pylori 2017
Brite
Enzymes [BR:hpq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     hp2017_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1396849..1397901
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCVYALSDMDLIKKAKESQLEPMPMGKALKEYQIKKTRDVGIGAKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLIPSAIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSIPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEAKLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDTEAKKIETFFEALKGKKPKIIYPEPPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcttggctttttcttgcgtttatgctttaagc
gatatggatttgattaaaaaagcgaaggaaagccagttagaacccatgcctatgggcaaa
gcgctcaaagaataccagatcaaaaaaaccagagatgtgggcattggcgctaaaaacagc
gaaatcatgacctccgctcaagtggaattgggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataacctgggcttaggtggggtggat
ctaatcccaagcgccataggctctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactccgtgtttaacgatgtgcagttttgggatggtagggttacgcattta
aacgaacaagcgcaagggccaatccaatcttcttttgaaatgggggctgatcctaaagtc
gtggtagaaaaaatcaattccataccaggctatgtcaagctctttagaaaagcttatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccaag
ctcatcaccccaagccgttacgatgattttttaaggggcaatcctaaagcactcagtaag
gccgaaaaagaggggctggatttattcatttctaaaggctgtgtggcttgccataatggc
attaatcttggggggacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattctgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatacagaagcgaaaaagattgaa
accttctttgaagccttaaagggtaaaaaacctaaaataatctacccagaaccccctgtg
atgacggacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system