KEGG   Haemophilus parainfluenzae: PARA_00480Help
Entry
PARA_00480        CDS       T01605                                 

Definition
beta N-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hpr  Haemophilus parainfluenzae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PARA_00480
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PARA_00480
Enzymes [BR:hpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PARA_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(44083..45126)
Genome map
AA seq 347 aa AA seqDB search
MSTLLIDLEGHELKQEEVDLLEHPLVAGMILFTRNFYDRQQVQALIKSIRQRVKKPLLIT
VDQEGGRVQRFREGFTQLPAMQAFAALVKDSTQQQQIAKEAGWQMAAEMVALDIDLSFAP
VLDLGHECRAIGDRSFGCDVKSAVNLAAAFIDGMHQAGMATTGKHFPGHGHVLADSHLET
PYDERAKEVIFNHDILPFQQLIHQSKLDAIMPAHVIYTQCDSQPASGSSYWLKEILRKQL
GFQGAIFSDDLGMKGAGFMGDFVARSEKALNAGCDLLLLCNEREGVIQVLDNLKLEETTE
HFAARQTRLKSLFKQKSFDWSELTKTSRWIENHQKLTALQQEWLASK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtccacattattaattgaccttgaaggtcatgagctcaaacaagaagaagttgactta
ctggaacatcctttagttgccggtatgattttatttacccgcaatttttatgatcgtcag
caagttcaagcgttaattaaatctattcgtcaacgagtgaaaaagcctttattgatcacg
gtcgatcaagaaggtggtcgtgtgcaacgtttccgcgaaggtttcactcagctccccgcg
atgcaagcttttgcggcattagttaaggattcaactcagcaacaacaaatagcaaaagaa
gcgggttggcaaatggcggctgaaatggtggcgctagatattgatttgagttttgctccg
gtgttggatttggggcatgaatgtcgtgcgattggcgatcgtagttttggctgtgatgta
aaaagtgcggtcaatttggcagccgcttttattgatggtatgcaccaagcaggcatggca
acaacaggaaaacattttccaggacacggtcatgttttagccgattctcatcttgaaacc
ccttatgatgagcgtgcaaaagaagtgatttttaatcatgatattttgccattccagcaa
ttaattcaccagagtaagcttgatgcgattatgccggctcacgtgatttatacgcaatgt
gatagccagccagcaagtggttcgagttattggctgaaagaaattttgcgtaaacagctg
ggcttccaaggggcgattttctctgatgatttaggcatgaagggcgcaggttttatgggt
gattttgtggctcgtagtgagaaagccttgaatgctggttgtgacttattattgctttgc
aatgaacgagaaggtgtcattcaagtgcttgataatcttaagttagaggaaaccacagag
cattttgcagcacgccaaactcgcttgaaatcgctctttaaacaaaaatcctttgattgg
tcagaactcaccaaaacttcacgttggattgaaaatcatcaaaaactgaccgcacttcaa
caagagtggcttgcttctaaatga

DBGET integrated database retrieval system