KEGG   Haemophilus parainfluenzae: PARA_02090Help
Entry
PARA_02090        CDS       T01605                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PARA_02090
Enzymes [BR:hpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PARA_02090
Exosome [BR:hpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PARA_02090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(207976..208998)
Genome map
AA seq 340 aa AA seqDB search
MTQQILGGFPTRRLRRLRKHDFSRRLVAENTLTANDLIYPVFIIEGENHREPVPSMPKVE
RLTIDQLLIEAGLLVKYGVPVIALFPVVEQDKKSLMADEAFNPNGLVQRAVKALKAAYPE
LGVLTDVALDPYTIHGQDGIIDEEGYVLNDITTDILIKQALSHAEAGADVVAPSDMMDGR
IGRIRQALEENGHINTQIMAYSAKYASNYYGPFRDAVGSAGNLKGGDKKTYQLDPANGNE
GLQEVALDLQEGADMVMVKPGMPYLDMVYRVKDYFGVPTFAYQVSGEYAMHMAAIQNGWL
KEKECIMESLLCFKRAGADGILTYFAKQVAEWLYLEGKNK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaaattttaggcggttttccaacccgtcgtcttcgtcgcttacgtaaacat
gattttagccgccgtttagtggcagaaaataccttaacagcgaatgatttaatttatccg
gtatttattattgaaggtgaaaatcatcgtgaaccagtgccttctatgcctaaagttgag
cgtttaaccatcgatcaattattaattgaagcaggccttttagtaaaatatggtgtgcca
gtgatcgcattattccctgtagttgagcaagataaaaaatctttaatggcagatgaagcg
tttaacccaaatggtttggtacagcgtgccgtaaaagcattgaaagctgcgtatccagaa
ttaggcgtattaactgatgtggcacttgatccttatactatccatggacaagatggcatc
attgatgaagaaggctatgtcttaaacgatatcacgacagatattctgatcaaacaggca
ctttcccatgctgaagcgggtgcagatgttgtggcaccgagtgatatgatggatggtcgt
attggccgtattcgtcaggcattggaagagaatggccatatcaatacacaaattatggcg
tactcagcgaaatatgcgtctaattactatggtccattccgtgatgcagttggttctgcg
ggtaatctgaaaggtggggataagaaaacttaccaacttgatccggcaaatggcaatgag
ggcttgcaagaagtcgcacttgatttacaagaaggcgcggatatggtgatggtgaaacca
ggtatgccatatttagacatggtatatcgtgtgaaagactatttcggcgtgccaaccttt
gcttatcaagtttctggtgaatatgcgatgcatatggcagccattcaaaatggttggctg
aaagaaaaagaatgcattatggaatcattgctttgctttaagcgtgcgggtgcggatggt
attttgacgtattttgcgaagcaagtcgctgaatggctttacttagaaggtaaaaataaa
taa

DBGET integrated database retrieval system