KEGG   Haemophilus parainfluenzae: PARA_04070Help
Entry
PARA_04070        CDS       T01605                                 

Definition
phage-related lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hpr  Haemophilus parainfluenzae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
410679..411197
Genome map
AA seq 172 aa AA seqDB search
MIKRTAKYACSVVAIVGLALSLHGHEIRTSEKGLLLTGNAEGCQRVPYNCPADVLTFGLG
TTDAVEKVIPHKVYTDEEIANAFTKGIKQAEKCVNTYANGQAMPQGAFDALVSITFNAGC
GNLKNSTLFKMARKGYSKAMCGQFERWIYANGVPLKGLIERRQKEKALCLGS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacgaacagcgaaatatgcatgcagtgttgtggcgattgtaggattggcactc
tctttacacgggcatgaaattagaacatcagaaaaaggcttgctattgactggcaatgca
gaaggatgtcaaagagtgccatataactgccctgcagatgtattaacatttgggctagga
accactgatgcagtcgaaaaagtcattccacataaagtctatacagatgaagaaattgca
aatgcctttacaaagggaattaaacaagccgaaaaatgtgtaaatacgtatgcaaacggt
caagcaatgccgcaaggtgcatttgatgccttagtgtcaattacctttaatgcaggatgc
gggaacttaaaaaacagcacgctttttaaaatggcaaggaaaggatatagcaaagccatg
tgcggtcaatttgaacgatggatttatgcaaacggcgttccactgaaaggcttaattgaa
agacgacaaaaggagaaagcattatgtttgggttcttaa

DBGET integrated database retrieval system