KEGG   Haemophilus parainfluenzae: PARA_04760Help
Entry
PARA_04760        CDS       T01605                                 

Definition
phosphoglyceromutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:hpr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpr00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:hpr00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hpr00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471141..471824
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLFEKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPKDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtattcattcgtcacggtttcagtgagtggaacgcaaaaaatttattcacc
ggttggcgtgatgtgaatttaactgagcgcggtgttgaagaagcaaaagcagcgggtaaa
aaattgttcgagaaaggctatgagttcgatatcgccttcacttctgttttaactcgtgca
atcaaaacctgtaacatcgtgttagaagaatctcaccaattatggattcctcaagtgaaa
aattggcgtttaaatgagcgtcactacggtgcattacaaggcttagataaaaaagcaacc
gcagaacaatacggtgacgaacaagttcatatctggcgtcgttcttatgacatttctcct
ccagatttagatccgaaagatccaaattctgcacataacgaccgtcgttatgcaaacatc
ccatctgatgttgtaccaaacgcagaaaacttaaaattaaccttagaacgtgcattacca
ttctgggaagatcaaattgctccagcaatgctttctggtaaacgtgttttagtggttgcg
cacggtaactcacttcgtgcattagcaaaacacatcatcggtatttctgatgcggaaatc
atggattttgaaatcccaactggtcaaccgctagtgttaaaacttgacgataaattaaac
tacgtagaacactactatctttaa

DBGET integrated database retrieval system