KEGG   Haemophilus parainfluenzae: PARA_04760Help
Entry
PARA_04760        CDS       T01605                                 

Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hpr  Haemophilus parainfluenzae
Pathway
hpr00010  Glycolysis / Gluconeogenesis
hpr00260  Glycine, serine and threonine metabolism
hpr00680  Methane metabolism
hpr01100  Metabolic pathways
hpr01110  Biosynthesis of secondary metabolites
hpr01120  Microbial metabolism in diverse environments
hpr01130  Biosynthesis of antibiotics
hpr01200  Carbon metabolism
hpr01230  Biosynthesis of amino acids
Module
hpr_M00002  Glycolysis, core module involving three-carbon compounds
hpr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PARA_04760
  Energy metabolism
   00680 Methane metabolism
    PARA_04760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PARA_04760
Enzymes [BR:hpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PARA_04760
Membrane trafficking [BR:hpr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PARA_04760
Exosome [BR:hpr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PARA_04760
  Exosomal proteins of melanoma cells
   PARA_04760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 FMO-like
Motif
Other DBs
NCBI-ProteinID: CBW14583
UniProt: E1W2J5
Position
471141..471824
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLFEKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPKDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtattcattcgtcacggtttcagtgagtggaacgcaaaaaatttattcacc
ggttggcgtgatgtgaatttaactgagcgcggtgttgaagaagcaaaagcagcgggtaaa
aaattgttcgagaaaggctatgagttcgatatcgccttcacttctgttttaactcgtgca
atcaaaacctgtaacatcgtgttagaagaatctcaccaattatggattcctcaagtgaaa
aattggcgtttaaatgagcgtcactacggtgcattacaaggcttagataaaaaagcaacc
gcagaacaatacggtgacgaacaagttcatatctggcgtcgttcttatgacatttctcct
ccagatttagatccgaaagatccaaattctgcacataacgaccgtcgttatgcaaacatc
ccatctgatgttgtaccaaacgcagaaaacttaaaattaaccttagaacgtgcattacca
ttctgggaagatcaaattgctccagcaatgctttctggtaaacgtgttttagtggttgcg
cacggtaactcacttcgtgcattagcaaaacacatcatcggtatttctgatgcggaaatc
atggattttgaaatcccaactggtcaaccgctagtgttaaaacttgacgataaattaaac
tacgtagaacactactatctttaa

DBGET integrated database retrieval system