KEGG   Haemophilus parainfluenzae: PARA_04760Help
Entry
PARA_04760        CDS       T01605                                 

Definition
phosphoglyceromutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PARA_04760
   01230 Biosynthesis of amino acids
    PARA_04760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PARA_04760
  Energy metabolism
   00680 Methane metabolism
    PARA_04760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PARA_04760
Enzymes [BR:hpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PARA_04760
Exosome [BR:hpr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PARA_04760
  Exosomal proteins of melanoma cells
   PARA_04760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471141..471824
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLFEKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPKDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtattcattcgtcacggtttcagtgagtggaacgcaaaaaatttattcacc
ggttggcgtgatgtgaatttaactgagcgcggtgttgaagaagcaaaagcagcgggtaaa
aaattgttcgagaaaggctatgagttcgatatcgccttcacttctgttttaactcgtgca
atcaaaacctgtaacatcgtgttagaagaatctcaccaattatggattcctcaagtgaaa
aattggcgtttaaatgagcgtcactacggtgcattacaaggcttagataaaaaagcaacc
gcagaacaatacggtgacgaacaagttcatatctggcgtcgttcttatgacatttctcct
ccagatttagatccgaaagatccaaattctgcacataacgaccgtcgttatgcaaacatc
ccatctgatgttgtaccaaacgcagaaaacttaaaattaaccttagaacgtgcattacca
ttctgggaagatcaaattgctccagcaatgctttctggtaaacgtgttttagtggttgcg
cacggtaactcacttcgtgcattagcaaaacacatcatcggtatttctgatgcggaaatc
atggattttgaaatcccaactggtcaaccgctagtgttaaaacttgacgataaattaaac
tacgtagaacactactatctttaa

DBGET integrated database retrieval system