KEGG   Haemophilus parainfluenzae: PARA_04930Help
Entry
PARA_04930        CDS       T01605                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PARA_04930
   01230 Biosynthesis of amino acids
    PARA_04930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PARA_04930
   00051 Fructose and mannose metabolism
    PARA_04930
   00562 Inositol phosphate metabolism
    PARA_04930
Enzymes [BR:hpr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PARA_04930
Exosome [BR:hpr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PARA_04930
  Exosomal proteins of bladder cancer cells
   PARA_04930
  Exosomal proteins of melanoma cells
   PARA_04930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487593..488384
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPVMYLGTAEAALSGCGC
SCGGKSVIQLGAQNVDINVKGAFTGDISSEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGVLKEAGLVPVLCIGETEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAEAAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagtgatgggtaactggaaattaaacggttccaaagcgttcacc
aaagaattaatcgaaggattaaaagcagaattacatgatgtaacaggttgtgatgtggca
attgccccaccagttatgtatttaggtacggctgaagcggcactttccggttgtggttgc
agctgtggcggtaaaagtgtgattcagttaggtgcacaaaacgtagatatcaatgtgaaa
ggtgcatttaccggtgatatttctagcgaaatgttaaaagattttggtgcaaaatacatc
attatcggtcactctgagcgtcgtacttaccacaaagaaagcgatgaattcgtagcgaaa
aaatttggtgtattaaaagaagcaggtttagtaccagtattatgtattggtgaaactgaa
gctgaaaacgaagcgggcaaaactgaagaagtatgtgcgcgtcaaattgatgcagtcatc
aatgcattaggtgtagaagcatttaatggtgcagtgattgcttacgaaccaatttgggca
atcggcacgggcaaatcagcaactccagcgcaagcacaagctgttcacgcatttatccgt
ggccacatcgcagcaaaatcacaagctgtagcagatcaagtgatcattcaatacggtggt
tcagtaaatgatgctaacgcagcagaattattcactcaaccggatatcgatggtgcatta
gtgggcggtgcttcacttaaagcgcctgcatttgcagtaattgtgaaagcagcggaagca
gcgaaaaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system