KEGG   Haemophilus parainfluenzae: PARA_04970Help
Entry
PARA_04970        CDS       T01605                                 

Definition
uroporphyrinogen III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PARA_04970
Enzymes [BR:hpr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PARA_04970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
492847..493611
Genome map
AA seq 254 aa AA seqDB search
MAVLVTRPDERGKALVDQLNQAGVVALHLPLLSIEAGAELAQLPTKLNQLKSGDYVFLVS
KSAVDFADKTLKDIGFSWRQDLQYFTVGHRTAQHFSCQTECTVRYPITSENTEGVLNLPQ
MAELTDKNLLILRGNGGRELLREQTTLRGATVETVECYQRTPISYNNEEQTSICIRSGVQ
TLVVTSLEILQALIEFVPENEQNWLKNCCLVTVSQRIADVAIQQGWHNVVVSAGADNQSL
LNTLLLNEVTPLSH
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgtactagtcactcgcccagatgaacgaggaaaagccctcgttgatcagctgaat
caagccggtgtggttgccttgcatttgcctttgctttctattgaggcgggtgctgagttg
gcacaattaccaacgaaacttaatcagctaaaaagtggtgattatgtgtttttggtatcc
aaaagtgcggtcgattttgcggataaaaccctgaaagatattggctttagctggcgtcaa
gatttacaatactttacagttggacatagaacggcacagcatttttcctgtcaaactgaa
tgtactgttcgttatccaatcacgtcggaaaatactgaaggcgtactaaatttaccgcaa
atggcagaattaacagataaaaacttgttaattttacgcggcaacggtggacgagaatta
ttacgcgaacagaccacactacgcggcgcaactgttgagacagtcgaatgttaccaacgc
acgccgattagttataataacgaagagcaaaccagtatttgtattcgttctggcgtgcaa
acccttgtggtaacaagccttgaaattttgcaggcgttaatcgaatttgtacctgaaaat
gaacaaaattggctaaaaaattgctgtttagtcacggtaagtcaacgcattgcggatgtt
gcaatacaacaaggttggcataatgtggtggtttccgccggtgcggacaatcaaagttta
cttaataccttacttcttaatgaagtaactcccctttctcactaa

DBGET integrated database retrieval system