KEGG   Haemophilus parainfluenzae: PARA_05950Help
Entry
PARA_05950        CDS       T01605                                 

Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PARA_05950
Enzymes [BR:hpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PARA_05950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589960..590895
Genome map
AA seq 311 aa AA seqDB search
MIREPHFHQFALAELLPFFEQFPTQYLSGERNIKLAYRHLVQPESAVRKLMILVNGRAEN
MLKWTELAYDFYQQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRFYTDDMAKIIEKTTALY
AYQAQYILAHSLGALISTYYLANYDHQIKKSVLSSPFFGVPMKHPLRDEVIIATMMAFGQ
GHRYVFGKGHYKPVDLNLNELSHSKTRMKWMNRVNRKRAAIHLGGPTFRWVHLCLNAIKA
LPKIIPRVETPVLILQAEKEKIVDNKNLEKLTALFPHAESMLVPQAKHEILFEKDNVRKA
VLERVNQFLHS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaacctcattttcatcaatttgctcttgcagagttattgcctttttttgag
caatttccgacgcaatatctttctggtgaacgaaatatcaaattagcttatcgtcatttg
gttcagcctgaaagtgcggtcagaaaattgatgattttggtgaatggtcgagcagaaaat
atgctgaaatggactgagttggcttatgatttttatcaacaaggttatgatgttttgctt
ttcgatcaccgaggacaaggctattcacagcgtattattcctcaaaaagggcatttagat
gagtttcgtttttataccgatgatatggcaaaaatcattgaaaaaacgaccgcactttat
gcttatcaagcgcaatatattctcgcacattccctcggcgctttaatttccacctattat
ctggccaattacgatcatcagattaaaaagtctgtactttcttcgcctttctttggtgtt
cccatgaaacatccgttacgagatgaagttatcattgcaacgatgatggcatttggccaa
ggtcatcgctatgtttttggtaaaggacattacaaaccggtagatttaaaccttaatgaa
cttagtcattctaaaacgcgaatgaaatggatgaaccgagttaatcgaaaacgcgctgct
attcacttaggcggcccgactttccgttgggtacatttgtgtttaaatgcaataaaagcg
cttcctaaaatcattccaagagtggaaacacctgtgcttattttacaagcggaaaaggaa
aaaattgtagataacaaaaatcttgaaaaattgactgcactttttccgcatgcagaatcc
atgcttgtacctcaagcaaaacatgaaattctttttgaaaaagataacgtgagaaaagcc
gtgcttgaacgcgtgaatcaatttcttcattcttaa

DBGET integrated database retrieval system