KEGG   Haemophilus parainfluenzae: PARA_06780Help
Entry
PARA_06780        CDS       T01605                                 

Definition
(GenBank) unnamed protein product
Organism
hpr  Haemophilus parainfluenzae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Redoxin Glutaredoxin AhpC-TSA GST_N_3 DUF836 Thioredoxin_2 GST_N_2
Motif
Other DBs
NCBI-ProteinID: CBW14785
UniProt: E1W345
Position
680433..681158
Genome map
AA seq 241 aa AA seqDB search
MSNMEGKKVPQVTFRTRQGDQWVDVTTSELFDNKTVVVFSLPGAFTPTCSSSHLPRYNEL
APVFKQHGVDDILVVSVNDTFVMNAWKEAEEAHNVKFIPDGNGTFTEGMGMLVGKDDLGF
GKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMLKYIAPDYQVQESIAIFTKPGC
PYCAKAKQLLRDKGLSFEEIVLGQDATIVSVRAVSGRATVPQVFIGGKHIGGSDDLEKYF
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatatggaaggaaaaaaagtcccacaagttacattccgtactcgtcaaggtgat
caatgggttgatgtaaccacatctgaattatttgataacaaaactgttgttgttttctca
ttaccaggtgcgttcacgccaacttgttcatcttctcacttaccacgttataacgagctt
gcacccgttttcaaacaacatggtgtagatgatattttagttgtatcagtaaatgatacg
tttgtgatgaatgcttggaaagaagctgaagaagcacataacgtaaaattcattccggat
ggtaacggtaccttcactgaaggtatgggcatgttagtcggaaaagatgatttaggtttt
ggtaaacgttcttggcgttattctatgctcgtgaaaaatggcgtagtggaaaaaatgttt
atcgaaccaaatgaaccaggcgatccgtttaaagtatctgatgccgataccatgttgaaa
tacattgcaccagattatcaagtgcaagaatcaatcgcaatcttcactaaaccaggttgc
ccatattgcgcgaaagcaaaacaacttttacgtgataaaggtttaagctttgaagaaatc
gtattaggtcaagatgcaactatcgtgagtgtacgtgcggtttctggtcgtgcaactgtg
ccacaagtattcatcggtggtaaacatattggcggtagcgacgatttagaaaaatacttt
gcataa

DBGET integrated database retrieval system