KEGG   Haemophilus parainfluenzae: PARA_06780Help
Entry
PARA_06780        CDS       T01605                                 

Definition
hypothetical protein
Organism
hpr  Haemophilus parainfluenzae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680433..681158
Genome map
AA seq 241 aa AA seqDB search
MSNMEGKKVPQVTFRTRQGDQWVDVTTSELFDNKTVVVFSLPGAFTPTCSSSHLPRYNEL
APVFKQHGVDDILVVSVNDTFVMNAWKEAEEAHNVKFIPDGNGTFTEGMGMLVGKDDLGF
GKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMLKYIAPDYQVQESIAIFTKPGC
PYCAKAKQLLRDKGLSFEEIVLGQDATIVSVRAVSGRATVPQVFIGGKHIGGSDDLEKYF
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatatggaaggaaaaaaagtcccacaagttacattccgtactcgtcaaggtgat
caatgggttgatgtaaccacatctgaattatttgataacaaaactgttgttgttttctca
ttaccaggtgcgttcacgccaacttgttcatcttctcacttaccacgttataacgagctt
gcacccgttttcaaacaacatggtgtagatgatattttagttgtatcagtaaatgatacg
tttgtgatgaatgcttggaaagaagctgaagaagcacataacgtaaaattcattccggat
ggtaacggtaccttcactgaaggtatgggcatgttagtcggaaaagatgatttaggtttt
ggtaaacgttcttggcgttattctatgctcgtgaaaaatggcgtagtggaaaaaatgttt
atcgaaccaaatgaaccaggcgatccgtttaaagtatctgatgccgataccatgttgaaa
tacattgcaccagattatcaagtgcaagaatcaatcgcaatcttcactaaaccaggttgc
ccatattgcgcgaaagcaaaacaacttttacgtgataaaggtttaagctttgaagaaatc
gtattaggtcaagatgcaactatcgtgagtgtacgtgcggtttctggtcgtgcaactgtg
ccacaagtattcatcggtggtaaacatattggcggtagcgacgatttagaaaaatacttt
gcataa

DBGET integrated database retrieval system