KEGG   Haemophilus parainfluenzae: PARA_07330Help
Entry
PARA_07330        CDS       T01605                                 

Definition
PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PARA_07330
Enzymes [BR:hpr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PARA_07330
Transfer RNA biogenesis [BR:hpr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PARA_07330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(718869..719675)
Genome map
AA seq 268 aa AA seqDB search
MQLSQSLLDQVRTLANEAGKHLARFYQQDVAIQTKSDNTPVTEADLFVSQFLIEKLTALF
PDIPVLSEENCNIPFEKRQTWQTYWLIDPLDGTQQFIDRTDQFSVLITLVQNHQPVLGVI
HFPILDITYYAMKGFGAFKQSDKEIKTLQPRKIDLTQPLKIAVGATTSQEKVRSILAKNL
ACEFTVVGSSSLKSGLVAEGAVDCYVRLGKTGEWDTAGAEILLAEINGGIFDPQFQPLTY
NQRESLINPNFVMVSDNTQNWASVFQFN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcaattatctcaatctcttctcgatcaagtccgcacgcttgccaatgaagcaggaaaa
catttggctcgtttttaccaacaggatgtggcaatacaaaccaaatcggataacacacct
gtcacagaggcggatttatttgtcagtcagtttttaatcgaaaaactgaccgcacttttc
cccgatattcctgttctttcagaggaaaactgcaatatcccctttgaaaaacgccaaact
tggcaaacctattggttgatcgatccccttgatggcacacagcaatttattgatcgtacg
gatcaattttccgttttgattacactcgtacaaaatcatcaacctgtactgggggttatt
cacttccctattttggatattacctattacgccatgaaaggtttcggcgcattcaaacag
agtgacaaagagataaaaaccttacaaccacgaaaaatcgatcttactcaaccgttaaaa
atcgccgtaggcgccaccacctcacaagaaaaagtgcggtcaattttagcgaagaatttg
gcatgcgaatttacggtagttggttcgagtagtttgaaaagcggtttggtcgcagaaggg
gcggttgattgctatgttcgcctcggtaaaaccggcgaatgggacaccgcgggcgctgaa
attttattagctgaaatcaatgggggaattttcgatccacaatttcagccactcacctat
aaccagcgtgaaagtttaattaatccaaactttgtgatggtgtcagataatacacaaaat
tgggcatctgtctttcaatttaattga

DBGET integrated database retrieval system