KEGG   Haemophilus parainfluenzae: PARA_07840Help
Entry
PARA_07840        CDS       T01605                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hpr  Haemophilus parainfluenzae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PARA_07840
Enzymes [BR:hpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PARA_07840
Exosome [BR:hpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PARA_07840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(772206..773717)
Genome map
AA seq 503 aa AA seqDB search
MTDKKYIIALDQGTTSSRAVLLDHNANVVEIAQREFTQIYPRAGWVEHNPMEIWATQSST
LNEVVAKAGITSDEIAAIGITNQRETTIVWEKATGTPVYNAIVWQCRRTADITDKLKADG
HEEYIRNTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFGTVDTWLVWKLTQGRVH
VTDYTNASRTMLFNIHTKKWDDKMLELLNIPRSMLPEVRNSSEVYGQTNIGGKGGVRIPV
AGIAGDQQAALYGHLCTRAGQAKNTYGTGCFMLLHTGDKAITSKNGLLTTIACNAKGEPE
YALEGSVFIAGASIQWLRDELKIVHDSHDSEYFAQKVPDSNGVYVVPAFTGLGAPYWDPY
ARGAIFGLSRGSNRNHIVRATLESIAYQTRDVLEAMQSDSGQRLQYLRVDGGATNNNFLM
QFQADILDVNVERPVVKEVTALGAAYLAGLAVGFWKDLDELHDKARVERTFTPDNDEEKR
ERRYKGWKKAVKRSLEWAKEDAE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaaaaatacatcatcgctttggaccaaggtaccacaagctctcgtgcagta
ttattagatcacaatgcgaatgttgtcgaaatcgcccaacgtgaatttacacaaatttat
ccacgcgcaggctgggtggaacataatccaatggaaatttgggcaacacaaagttcaaca
ttaaacgaagtggttgcaaaagcaggtattacctcagatgaaattgcggcaattggtatt
actaaccaacgtgaaaccaccattgtgtgggaaaaagcaactggcacaccggtttataat
gcgattgtgtggcaatgtcgtcgtactgcagatattacagacaaacttaaagcggatggt
catgaagaatatatccgcaacaccacaggtttagtggtggatccctatttctcaggtacc
aaagtaaaatggattttggacaatgtagaaggcgcgcgcgaaaaagcggaacgcggtgag
cttctattcggtaccgtagatacctggcttgtgtggaaattaacgcagggtcgtgttcac
gtaacggattacaccaacgcatcccgtaccatgttatttaacatccatacgaaaaaatgg
gatgacaaaatgttggaattattaaatattccacgctcaatgttgcctgaagtgcgtaat
tcttccgaagtgtatggccaaaccaacatcgggggtaaaggcggcgtgcgtattcctgtt
gcgggtatcgcgggtgaccaacaagcagcactttacggccatctttgcacacgcgcaggc
caagcaaaaaatacctatggtacaggctgctttatgttgcttcacaccggtgataaagcc
attacctctaaaaatggcctattaaccaccatcgcgtgtaacgccaaaggtgaacctgaa
tacgcacttgaaggttcggtatttatcgcgggcgcttcaatccaatggttacgtgatgaa
ctcaaaatcgttcatgacagccacgactccgaatactttgcacaaaaagttcctgacagc
aacggggtatatgtcgtaccagccttcactggtttaggcgcaccatattgggatccgtat
gcacgcggtgcaatttttggtctttctcgtggttctaaccgcaaccatattgtacgtgcg
acccttgaatctatcgcttaccaaacccgtgacgtattagaagcaatgcaatctgactca
ggtcaacgcttacaatatttacgtgttgatggcggtgcaaccaacaataacttcttaatg
caattccaagcggatattttagatgtgaacgtagaacgtccagtcgtgaaagaagtgact
gcacttggtgcagcttatcttgctggtcttgcggttggtttctggaaagatttagacgag
cttcacgacaaagcgcgtgtagaacgtaccttcacacctgataatgacgaagaaaaacgt
gaacgtcgttataaaggctggaaaaaagcggttaaacgctcattagaatgggcaaaagaa
gacgcggaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system