KEGG   Haemophilus parainfluenzae: PARA_09640Help
Entry
PARA_09640        CDS       T01605                                 

Definition
gap repair protein
Orthology
K06187  
recombination protein RecR
Organism
hpr  Haemophilus parainfluenzae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hpr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
961323..961925
Genome map
AA seq 200 aa AA seqDB search
MQSSPLLEHLIENLRCLPGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQC
RDFTEEETCNICNNPRRQNSGLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLDLLQKRLVEESFHEVILATNPTVEGDATANYIAEICHQHNIKVSRIAHGIPVGGE
LETVDGTTLTHSFLGRRQID
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagtccacttttagaacatcttattgaaaaccttcgttgcttgccgggtgtt
ggcccgaaatcagcgcagcgcatggcttatcatctcttacagcgcaatcgtagcggtggg
atgaatttagcacgtgcattaacggaagcgatgtctaaaattgggcattgttcacagtgt
cgtgattttaccgaagaggaaacgtgcaatatttgtaacaatcctcgccgtcaaaattca
ggtttgctttgcgtggtggaaatgccggcggatattcaggctattgagcaaacaggccaa
ttttctgggcgttattttgtcttaatggggcacttatcgcctttagatggtattggccca
aaagagattggtttagatttattgcaaaaacgtctggtagaagaatctttccacgaagtg
attttagcgaccaatccaacggtggaaggcgatgccacagccaattatattgcggaaatt
tgccatcaacataatattaaagtgagtcgtattgctcacgggatccctgtcggtggggaa
ttagaaaccgtggacggcaccaccttaacccattctttcttaggtcgtcgtcagatcgac
taa

DBGET integrated database retrieval system